Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | brnT-relB/BrnT-RelB |
Location | 24275..24615 | Replicon | plasmid 1 |
Accession | NC_007968 | ||
Organism | Psychrobacter cryohalolentis K5 |
Toxin (Protein)
Gene name | brnT | Uniprot ID | - |
Locus tag | PCRYO_RS13125 | Protein ID | WP_011512349.1 |
Coordinates | 24275..24418 (-) | Length | 48 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A7W2MYR8 |
Locus tag | PCRYO_RS12880 | Protein ID | WP_011512369.1 |
Coordinates | 24415..24615 (-) | Length | 67 a.a. |
Genomic Context
Location: 19461..20270 (810 bp)
Type: Others
Protein ID: WP_011512343.1
Type: Others
Protein ID: WP_011512343.1
Location: 20480..21115 (636 bp)
Type: Others
Protein ID: WP_011512344.1
Type: Others
Protein ID: WP_011512344.1
Location: 21128..21331 (204 bp)
Type: Others
Protein ID: WP_041753792.1
Type: Others
Protein ID: WP_041753792.1
Location: 21589..22599 (1011 bp)
Type: Others
Protein ID: WP_011512346.1
Type: Others
Protein ID: WP_011512346.1
Location: 22605..23591 (987 bp)
Type: Others
Protein ID: WP_011512347.1
Type: Others
Protein ID: WP_011512347.1
Location: 25908..26282 (375 bp)
Type: Others
Protein ID: WP_011512351.1
Type: Others
Protein ID: WP_011512351.1
Location: 26924..27871 (948 bp)
Type: Others
Protein ID: WP_011512352.1
Type: Others
Protein ID: WP_011512352.1
Location: 28031..29158 (1128 bp)
Type: Others
Protein ID: WP_011512353.1
Type: Others
Protein ID: WP_011512353.1
Location: 23751..24047 (297 bp)
Type: Others
Protein ID: WP_041753794.1
Type: Others
Protein ID: WP_041753794.1
Location: 24275..24418 (144 bp)
Type: Toxin
Protein ID: WP_011512349.1
Type: Toxin
Protein ID: WP_011512349.1
Location: 24415..24615 (201 bp)
Type: Antitoxin
Protein ID: WP_011512369.1
Type: Antitoxin
Protein ID: WP_011512369.1
Location: 24717..24977 (261 bp)
Type: Others
Protein ID: WP_011512370.1
Type: Others
Protein ID: WP_011512370.1
Location: 25045..25446 (402 bp)
Type: Others
Protein ID: WP_011512350.1
Type: Others
Protein ID: WP_011512350.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PCRYO_RS12845 | 19461..20270 | + | 810 | WP_011512343.1 | hypothetical protein | - |
PCRYO_RS12850 | 20480..21115 | + | 636 | WP_011512344.1 | AAA family ATPase | - |
PCRYO_RS12855 | 21128..21331 | + | 204 | WP_041753792.1 | hypothetical protein | - |
PCRYO_RS12860 | 21589..22599 | + | 1011 | WP_011512346.1 | AAA family ATPase | - |
PCRYO_RS12865 | 22605..23591 | + | 987 | WP_011512347.1 | DUF4435 domain-containing protein | - |
PCRYO_RS12870 | 23751..24047 | - | 297 | WP_041753794.1 | hypothetical protein | - |
PCRYO_RS13125 | 24275..24418 | - | 144 | WP_011512349.1 | BrnT family toxin | Toxin |
PCRYO_RS12880 | 24415..24615 | - | 201 | WP_011512369.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PCRYO_RS12885 | 24717..24977 | - | 261 | WP_011512370.1 | hypothetical protein | - |
PCRYO_RS12890 | 25045..25446 | - | 402 | WP_011512350.1 | hypothetical protein | - |
PCRYO_RS12895 | 25908..26282 | + | 375 | WP_011512351.1 | hypothetical protein | - |
PCRYO_RS12900 | 26924..27871 | + | 948 | WP_011512352.1 | replication initiation protein RepM | - |
PCRYO_RS12905 | 28031..29158 | + | 1128 | WP_011512353.1 | DUF262 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..41221 | 41221 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5780.34 Da Isoelectric Point: 4.4963
>T21564 WP_011512349.1 NC_007968:c24418-24275 [Psychrobacter cryohalolentis K5]
MIEFEWDEQKNSSNQRKHGLCFEEAARVFFDPLCLRQQDRYENGEER
MIEFEWDEQKNSSNQRKHGLCFEEAARVFFDPLCLRQQDRYENGEER
Download Length: 144 bp
>T21564 NC_007968:c24418-24275 [Psychrobacter cryohalolentis K5]
ATGATTGAATTTGAATGGGATGAACAGAAAAATAGCAGTAATCAACGCAAACATGGCTTATGCTTTGAAGAAGCAGCTCG
GGTATTTTTTGATCCTTTGTGTTTGCGTCAACAAGACCGATATGAAAACGGTGAAGAGCGGTAG
ATGATTGAATTTGAATGGGATGAACAGAAAAATAGCAGTAATCAACGCAAACATGGCTTATGCTTTGAAGAAGCAGCTCG
GGTATTTTTTGATCCTTTGTGTTTGCGTCAACAAGACCGATATGAAAACGGTGAAGAGCGGTAG
Antitoxin
Download Length: 67 a.a. Molecular weight: 7427.25 Da Isoelectric Point: 4.1313
>AT21564 WP_011512369.1 NC_007968:c24615-24415 [Psychrobacter cryohalolentis K5]
MSTTNYNIRLDQELKDKAFSVLEGYGLTPSQAIKLFLHQVAETNSIPLSFDYQTMPSTNTLEDGDQ
MSTTNYNIRLDQELKDKAFSVLEGYGLTPSQAIKLFLHQVAETNSIPLSFDYQTMPSTNTLEDGDQ
Download Length: 201 bp
>AT21564 NC_007968:c24615-24415 [Psychrobacter cryohalolentis K5]
ATGAGCACAACCAATTATAATATCCGTCTCGATCAAGAATTAAAAGACAAGGCGTTTTCGGTGCTTGAAGGCTATGGTTT
AACGCCTTCTCAGGCGATTAAGTTATTTTTGCATCAGGTAGCAGAAACCAATAGCATACCGCTGTCTTTTGATTACCAGA
CAATGCCTAGTACCAATACGCTTGAAGACGGTGATCAATGA
ATGAGCACAACCAATTATAATATCCGTCTCGATCAAGAATTAAAAGACAAGGCGTTTTCGGTGCTTGAAGGCTATGGTTT
AACGCCTTCTCAGGCGATTAAGTTATTTTTGCATCAGGTAGCAGAAACCAATAGCATACCGCTGTCTTTTGATTACCAGA
CAATGCCTAGTACCAATACGCTTGAAGACGGTGATCAATGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7W2MYR8 |