Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbE-relB/ParE-YafN |
| Location | 1140997..1141522 | Replicon | chromosome |
| Accession | NZ_CP082238 | ||
| Organism | Acidithiobacillus ferrooxidans strain BYM | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | B7J6U7 |
| Locus tag | K7B00_RS05935 | Protein ID | WP_009564272.1 |
| Coordinates | 1141241..1141522 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | B7J6U6 |
| Locus tag | K7B00_RS05930 | Protein ID | WP_009564270.1 |
| Coordinates | 1140997..1141251 (+) | Length | 85 a.a. |
Genomic Context
Location: 1137058..1137357 (300 bp)
Type: Others
Protein ID: WP_226834093.1
Type: Others
Protein ID: WP_226834093.1
Location: 1137526..1138194 (669 bp)
Type: Others
Protein ID: WP_009561118.1
Type: Others
Protein ID: WP_009561118.1
Location: 1138191..1139354 (1164 bp)
Type: Others
Protein ID: WP_012536412.1
Type: Others
Protein ID: WP_012536412.1
Location: 1139351..1139470 (120 bp)
Type: Others
Protein ID: WP_009564254.1
Type: Others
Protein ID: WP_009564254.1
Location: 1139463..1139753 (291 bp)
Type: Others
Protein ID: WP_041645337.1
Type: Others
Protein ID: WP_041645337.1
Location: 1139928..1140263 (336 bp)
Type: Others
Protein ID: WP_012536413.1
Type: Others
Protein ID: WP_012536413.1
Location: 1140456..1140749 (294 bp)
Type: Others
Protein ID: WP_012606678.1
Type: Others
Protein ID: WP_012606678.1
Location: 1140997..1141251 (255 bp)
Type: Antitoxin
Protein ID: WP_009564270.1
Type: Antitoxin
Protein ID: WP_009564270.1
Location: 1141241..1141522 (282 bp)
Type: Toxin
Protein ID: WP_009564272.1
Type: Toxin
Protein ID: WP_009564272.1
Location: 1143443..1144495 (1053 bp)
Type: Others
Protein ID: WP_012536417.1
Type: Others
Protein ID: WP_012536417.1
Location: 1136044..1136538 (495 bp)
Type: Others
Protein ID: WP_257246173.1
Type: Others
Protein ID: WP_257246173.1
Location: 1136521..1136715 (195 bp)
Type: Others
Protein ID: Protein_1158
Type: Others
Protein ID: Protein_1158
Location: 1136871..1137065 (195 bp)
Type: Others
Protein ID: WP_225487690.1
Type: Others
Protein ID: WP_225487690.1
Location: 1142065..1143288 (1224 bp)
Type: Others
Protein ID: WP_012536416.1
Type: Others
Protein ID: WP_012536416.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K7B00_RS05890 (K7B00_05890) | 1136044..1136538 | - | 495 | WP_257246173.1 | LysR substrate-binding domain-containing protein | - |
| K7B00_RS16705 | 1136521..1136715 | - | 195 | Protein_1158 | LysR family transcriptional regulator | - |
| K7B00_RS16710 | 1136871..1137065 | - | 195 | WP_225487690.1 | hypothetical protein | - |
| K7B00_RS05895 (K7B00_05895) | 1137058..1137357 | + | 300 | WP_226834093.1 | SDR family oxidoreductase | - |
| K7B00_RS05900 (K7B00_05900) | 1137526..1138194 | + | 669 | WP_009561118.1 | cupin domain-containing protein | - |
| K7B00_RS05905 (K7B00_05905) | 1138191..1139354 | + | 1164 | WP_012536412.1 | FAD-dependent oxidoreductase | - |
| K7B00_RS05910 (K7B00_05910) | 1139351..1139470 | + | 120 | WP_009564254.1 | short-chain dehydrogenase | - |
| K7B00_RS05915 (K7B00_05915) | 1139463..1139753 | + | 291 | WP_041645337.1 | hypothetical protein | - |
| K7B00_RS05920 (K7B00_05920) | 1139928..1140263 | + | 336 | WP_012536413.1 | shufflon-specific DNA recombinase | - |
| K7B00_RS05925 (K7B00_05925) | 1140456..1140749 | + | 294 | WP_012606678.1 | YbjQ family protein | - |
| K7B00_RS05930 (K7B00_05930) | 1140997..1141251 | + | 255 | WP_009564270.1 | antitoxin | Antitoxin |
| K7B00_RS05935 (K7B00_05935) | 1141241..1141522 | + | 282 | WP_009564272.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| K7B00_RS05945 (K7B00_05945) | 1142065..1143288 | - | 1224 | WP_012536416.1 | class I SAM-dependent rRNA methyltransferase | - |
| K7B00_RS05950 (K7B00_05950) | 1143443..1144495 | + | 1053 | WP_012536417.1 | S-methyl-5-thioribose-1-phosphate isomerase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10757.61 Da Isoelectric Point: 10.6855
>T214440 WP_009564272.1 NZ_CP082238:1141241-1141522 [Acidithiobacillus ferrooxidans]
MPYELTFHPSALKEWQALDHSVRAPFKKKLAERLVHPRVPSAQLHGHPDRYKIKLRSIGYRLIYQVMETEVQVLVLAVGK
REGSVAYHKAKGR
MPYELTFHPSALKEWQALDHSVRAPFKKKLAERLVHPRVPSAQLHGHPDRYKIKLRSIGYRLIYQVMETEVQVLVLAVGK
REGSVAYHKAKGR
Download Length: 282 bp
>T214440 NZ_CP110074:c2716246-2716103 [Enterococcus faecalis]
ATGAGCGTACTTCCAAAATTTACAGAAAGGAGAGGCCTGTTGTCAGCATATGAGACAATTCAGACGATCCTAGGTTTTGG
TATGTTTACCATTGCTTTGATTGCACTGATTGTGAAATTGCTTAAAAATGACAAGAAAAAATAA
ATGAGCGTACTTCCAAAATTTACAGAAAGGAGAGGCCTGTTGTCAGCATATGAGACAATTCAGACGATCCTAGGTTTTGG
TATGTTTACCATTGCTTTGATTGCACTGATTGTGAAATTGCTTAAAAATGACAAGAAAAAATAA
Antitoxin
Download Length: 85 a.a. Molecular weight: 8832.16 Da Isoelectric Point: 4.6615
>AT214440 WP_009564270.1 NZ_CP082238:1140997-1141251 [Acidithiobacillus ferrooxidans]
MTHVILADVAASVSELKKNPMGTVAAGEGATVAILNRNEPAFYCVPAATYAALLEHLENLELNALAESRLKDGQTPIKVS
LDAL
MTHVILADVAASVSELKKNPMGTVAAGEGATVAILNRNEPAFYCVPAATYAALLEHLENLELNALAESRLKDGQTPIKVS
LDAL
Download Length: 255 bp
>AT214440 NZ_CP110074:2715984-2716170 [Enterococcus faecalis]
TGTGCTAGAATGTAGATGAAAAGAGAGATATGCGTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACCGATT
GTATTATTTAAAAATAACCGTACTGGTCAAAGTAGATGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGTG
CAATCAAAGCAATGGTAAACATACCAA
TGTGCTAGAATGTAGATGAAAAGAGAGATATGCGTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACCGATT
GTATTATTTAAAAATAACCGTACTGGTCAAAGTAGATGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGTG
CAATCAAAGCAATGGTAAACATACCAA