Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 735260..735786 | Replicon | chromosome |
Accession | NZ_CP082029 | ||
Organism | Klebsiella pneumoniae strain KP18-2113 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | K6164_RS03680 | Protein ID | WP_000323025.1 |
Coordinates | 735260..735547 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | K6164_RS03685 | Protein ID | WP_000534858.1 |
Coordinates | 735547..735786 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K6164_RS03650 (730306) | 730306..730539 | - | 234 | WP_004181905.1 | hypothetical protein | - |
K6164_RS03655 (730618) | 730618..730965 | - | 348 | WP_004181904.1 | hypothetical protein | - |
K6164_RS03660 (731121) | 731121..732188 | - | 1068 | WP_004181903.1 | hypothetical protein | - |
K6164_RS03665 (732878) | 732878..733255 | + | 378 | WP_004181901.1 | hypothetical protein | - |
K6164_RS03670 (733453) | 733453..734427 | - | 975 | WP_004181899.1 | hypothetical protein | - |
K6164_RS03675 (735030) | 735030..735188 | - | 159 | WP_004181898.1 | type I toxin-antitoxin system Hok family toxin | - |
K6164_RS03680 (735260) | 735260..735547 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
K6164_RS03685 (735547) | 735547..735786 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
K6164_RS28235 (735811) | 735811..735915 | + | 105 | Protein_713 | hypothetical protein | - |
K6164_RS03690 (736049) | 736049..736372 | - | 324 | WP_224948387.1 | cation transporter dimerization domain-containing protein | - |
K6164_RS03695 (736538) | 736538..737706 | + | 1169 | WP_085929673.1 | IS3-like element ISEc52 family transposase | - |
K6164_RS03700 (737767) | 737767..739050 | + | 1284 | WP_223819051.1 | DEAD/DEAH box helicase | - |
K6164_RS03705 (739318) | 739318..739932 | - | 615 | WP_004026303.1 | lytic transglycosylase domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | aac(3)-IId / blaSHV-187 / mph(E) / msr(E) / armA / sul1 / blaDHA-1 / qnrB4 | fimA / fimI / fimC / fimD / fimD / fimF / fimG / rmpA / iutA / iucD / iucC / iucB / iucA | 579774..844483 | 264709 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T214006 WP_000323025.1 NZ_CP082029:c735547-735260 [Klebsiella pneumoniae]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
>T214006 NZ_CP109933:2441496-2441603 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 80 a.a. Molecular weight: 9071.48 Da Isoelectric Point: 4.5230
>AT214006 WP_000534858.1 NZ_CP082029:c735786-735547 [Klebsiella pneumoniae]
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
Download Length: 240 bp
>AT214006 NZ_CP109933:c2441680-2441620 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|