Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1286645..1287276 | Replicon | chromosome |
Accession | NZ_CP081490 | ||
Organism | Pseudomonas protegens strain PS1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | K5F93_RS06115 | Protein ID | WP_221810962.1 |
Coordinates | 1286878..1287276 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | K5F93_RS06110 | Protein ID | WP_102860368.1 |
Coordinates | 1286645..1286878 (+) | Length | 78 a.a. |
Genomic Context
Location: 1282315..1283442 (1128 bp)
Type: Others
Protein ID: WP_110652277.1
Type: Others
Protein ID: WP_110652277.1
Location: 1283482..1283841 (360 bp)
Type: Others
Protein ID: WP_221810959.1
Type: Others
Protein ID: WP_221810959.1
Location: 1283976..1284416 (441 bp)
Type: Others
Protein ID: WP_221810960.1
Type: Others
Protein ID: WP_221810960.1
Location: 1284421..1285005 (585 bp)
Type: Others
Protein ID: WP_060840910.1
Type: Others
Protein ID: WP_060840910.1
Location: 1286645..1286878 (234 bp)
Type: Antitoxin
Protein ID: WP_102860368.1
Type: Antitoxin
Protein ID: WP_102860368.1
Location: 1286878..1287276 (399 bp)
Type: Toxin
Protein ID: WP_221810962.1
Type: Toxin
Protein ID: WP_221810962.1
Location: 1287753..1289801 (2049 bp)
Type: Others
Protein ID: WP_221810963.1
Type: Others
Protein ID: WP_221810963.1
Location: 1289938..1290507 (570 bp)
Type: Others
Protein ID: WP_221810964.1
Type: Others
Protein ID: WP_221810964.1
Location: 1285030..1286277 (1248 bp)
Type: Others
Protein ID: WP_221810961.1
Type: Others
Protein ID: WP_221810961.1
Location: 1287299..1287412 (114 bp)
Type: Others
Protein ID: WP_260627405.1
Type: Others
Protein ID: WP_260627405.1
Location: 1290517..1290879 (363 bp)
Type: Others
Protein ID: WP_221810965.1
Type: Others
Protein ID: WP_221810965.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K5F93_RS06085 (K5F93_06085) | 1282315..1283442 | + | 1128 | WP_110652277.1 | UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing) | - |
K5F93_RS06090 (K5F93_06090) | 1283482..1283841 | + | 360 | WP_221810959.1 | amidohydrolase family protein | - |
K5F93_RS06095 (K5F93_06095) | 1283976..1284416 | + | 441 | WP_221810960.1 | DUF3592 domain-containing protein | - |
K5F93_RS06100 (K5F93_06100) | 1284421..1285005 | + | 585 | WP_060840910.1 | hypothetical protein | - |
K5F93_RS06105 (K5F93_06105) | 1285030..1286277 | - | 1248 | WP_221810961.1 | aspartate aminotransferase family protein | - |
K5F93_RS06110 (K5F93_06110) | 1286645..1286878 | + | 234 | WP_102860368.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
K5F93_RS06115 (K5F93_06115) | 1286878..1287276 | + | 399 | WP_221810962.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
K5F93_RS06120 (K5F93_06120) | 1287299..1287412 | - | 114 | WP_260627405.1 | DUF2938 domain-containing protein | - |
K5F93_RS06125 (K5F93_06125) | 1287753..1289801 | + | 2049 | WP_221810963.1 | c-type cytochrome | - |
K5F93_RS06130 (K5F93_06130) | 1289938..1290507 | + | 570 | WP_221810964.1 | hypothetical protein | - |
K5F93_RS06135 (K5F93_06135) | 1290517..1290879 | - | 363 | WP_221810965.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15063.42 Da Isoelectric Point: 7.9035
>T212928 WP_221810962.1 NZ_CP081490:1286878-1287276 [Pseudomonas protegens]
MLKYMLDTNICIFTIKNKPEQVREAFRRHQGRLCISTITLMELIYGAEKSAIPEKNLSRVESFVARLQVLDYDDAAAIHS
GQLHAELVRQGKQIGPYDQLIAGHARSLGLTLITNNLREFERVPGLRVEDWV
MLKYMLDTNICIFTIKNKPEQVREAFRRHQGRLCISTITLMELIYGAEKSAIPEKNLSRVESFVARLQVLDYDDAAAIHS
GQLHAELVRQGKQIGPYDQLIAGHARSLGLTLITNNLREFERVPGLRVEDWV
Download Length: 399 bp
>T212928 NZ_CP107404:c78392-78243 [Klebsiella pneumoniae]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 78 a.a. Molecular weight: 8787.73 Da Isoelectric Point: 4.2342
>AT212928 WP_102860368.1 NZ_CP081490:1286645-1286878 [Pseudomonas protegens]
METGSVFKSNRSQAIRMPKAVALPDDVTRVDIVAIGRTRIITPAGESWDSWFDEDDRVSADFMNERDQPAEQVREEF
METGSVFKSNRSQAIRMPKAVALPDDVTRVDIVAIGRTRIITPAGESWDSWFDEDDRVSADFMNERDQPAEQVREEF
Download Length: 234 bp
>AT212928 NZ_CP107404:78437-78496 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT