Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4282620..4283146 | Replicon | chromosome |
Accession | NZ_CP081009 | ||
Organism | Escherichia coli strain Stbl4 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | K3830_RS20615 | Protein ID | WP_000323025.1 |
Coordinates | 4282859..4283146 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | K3830_RS20610 | Protein ID | WP_000534858.1 |
Coordinates | 4282620..4282859 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K3830_RS20555 (4277647) | 4277647..4278414 | - | 768 | Protein_4046 | exonuclease | - |
K3830_RS20560 (4278507) | 4278507..4278698 | - | 192 | WP_001083297.1 | lysis protein YdfD | - |
K3830_RS20565 (4278695) | 4278695..4278883 | - | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
K3830_RS20570 (4279451) | 4279451..4279669 | - | 219 | WP_001171942.1 | protein YdfC | - |
K3830_RS22345 (4279699) | 4279699..4279827 | - | 129 | WP_000344964.1 | protein YdfB | - |
K3830_RS20575 (4279829) | 4279829..4279984 | - | 156 | WP_000379575.1 | DUF1391 family protein | - |
K3830_RS20580 (4280151) | 4280151..4280558 | - | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
K3830_RS20585 (4280642) | 4280642..4280872 | + | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
K3830_RS20590 (4280856) | 4280856..4281134 | + | 279 | Protein_4054 | hypothetical protein | - |
K3830_RS20595 (4281169) | 4281169..4281318 | + | 150 | WP_011443592.1 | protein YdfW | - |
K3830_RS20600 (4281755) | 4281755..4282087 | - | 333 | WP_001301033.1 | FlxA-like family protein | - |
K3830_RS20605 (4282290) | 4282290..4282595 | - | 306 | WP_001326990.1 | protein YdfV | - |
K3830_RS20610 (4282620) | 4282620..4282859 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
K3830_RS20615 (4282859) | 4282859..4283146 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
K3830_RS20620 (4283218) | 4283218..4283373 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
K3830_RS20625 (4283590) | 4283590..4283841 | + | 252 | WP_000980994.1 | protein Rem | - |
K3830_RS20630 (4283908) | 4283908..4284186 | + | 279 | WP_012304870.1 | hypothetical protein | - |
K3830_RS20635 (4284188) | 4284188..4285237 | + | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
K3830_RS20640 (4285251) | 4285251..4286003 | + | 753 | WP_001047135.1 | antitermination protein | - |
K3830_RS20645 (4286281) | 4286281..4286370 | - | 90 | WP_120795389.1 | hypothetical protein | - |
K3830_RS20650 (4286425) | 4286425..4286637 | - | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
K3830_RS20655 (4286938) | 4286938..4287153 | + | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
K3830_RS20660 (4287517) | 4287517..4287687 | - | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
K3830_RS20665 (4287907) | 4287907..4288122 | + | 216 | WP_000839590.1 | phage lysis protein EssD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4277374..4295428 | 18054 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T212543 WP_000323025.1 NZ_CP081009:4282859-4283146 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
>T212543 NZ_CP107262:4598482-4598584 [Leclercia adecarboxylata]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 80 a.a. Molecular weight: 9071.48 Da Isoelectric Point: 4.5230
>AT212543 WP_000534858.1 NZ_CP081009:4282620-4282859 [Escherichia coli]
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
Download Length: 240 bp
>AT212543 NZ_CP107262:c4598596-4598416 [Leclercia adecarboxylata]
CTTTCAACAGATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCT
AAAAGTTGGCATTAATGCAGGCTAAGTCGCCTTGCACTTTAAGAATAGATGACGACGCCAGGTTTTCCAGTCCGCAGCAA
AAGTGGCCTGAAAAAAAGCGT
CTTTCAACAGATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCT
AAAAGTTGGCATTAATGCAGGCTAAGTCGCCTTGCACTTTAAGAATAGATGACGACGCCAGGTTTTCCAGTCCGCAGCAA
AAGTGGCCTGAAAAAAAGCGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|