Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relE-vapB/- |
Location | 1183571..1184189 | Replicon | chromosome |
Accession | NC_006513 | ||
Organism | Aromatoleum aromaticum EbN1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q5P629 |
Locus tag | EB_RS05590 | Protein ID | WP_011236956.1 |
Coordinates | 1183571..1183855 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | EB_RS05595 | Protein ID | WP_011236957.1 |
Coordinates | 1183986..1184189 (+) | Length | 68 a.a. |
Genomic Context
Location: 1181424..1181840 (417 bp)
Type: Others
Protein ID: WP_011236951.1
Type: Others
Protein ID: WP_011236951.1
Location: 1181958..1182230 (273 bp)
Type: Others
Protein ID: Protein_1099
Type: Others
Protein ID: Protein_1099
Location: 1182291..1182563 (273 bp)
Type: Others
Protein ID: WP_011236953.1
Type: Others
Protein ID: WP_011236953.1
Location: 1182560..1183054 (495 bp)
Type: Others
Protein ID: WP_011236954.1
Type: Others
Protein ID: WP_011236954.1
Location: 1183254..1183568 (315 bp)
Type: Others
Protein ID: WP_011236955.1
Type: Others
Protein ID: WP_011236955.1
Location: 1183571..1183855 (285 bp)
Type: Toxin
Protein ID: WP_011236956.1
Type: Toxin
Protein ID: WP_011236956.1
Location: 1183986..1184189 (204 bp)
Type: Antitoxin
Protein ID: WP_011236957.1
Type: Antitoxin
Protein ID: WP_011236957.1
Location: 1184186..1184569 (384 bp)
Type: Others
Protein ID: WP_011236958.1
Type: Others
Protein ID: WP_011236958.1
Location: 1185132..1185815 (684 bp)
Type: Others
Protein ID: Protein_1107
Type: Others
Protein ID: Protein_1107
Location: 1186050..1187618 (1569 bp)
Type: Others
Protein ID: WP_011236587.1
Type: Others
Protein ID: WP_011236587.1
Location: 1187641..1188375 (735 bp)
Type: Others
Protein ID: WP_011235973.1
Type: Others
Protein ID: WP_011235973.1
Location: 1188579..1188992 (414 bp)
Type: Others
Protein ID: Protein_1110
Type: Others
Protein ID: Protein_1110
Location: 1178930..1180441 (1512 bp)
Type: Others
Protein ID: WP_011236949.1
Type: Others
Protein ID: WP_011236949.1
Location: 1180604..1181143 (540 bp)
Type: Others
Protein ID: WP_011236950.1
Type: Others
Protein ID: WP_011236950.1
Location: 1184566..1185006 (441 bp)
Type: Others
Protein ID: WP_157866582.1
Type: Others
Protein ID: WP_157866582.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EB_RS05555 | 1178930..1180441 | - | 1512 | WP_011236949.1 | PHB depolymerase family esterase | - |
EB_RS24130 | 1180604..1181143 | - | 540 | WP_011236950.1 | sel1 repeat family protein | - |
EB_RS05565 | 1181424..1181840 | + | 417 | WP_011236951.1 | pilin | - |
EB_RS05570 | 1181958..1182230 | + | 273 | Protein_1099 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
EB_RS05575 | 1182291..1182563 | + | 273 | WP_011236953.1 | DUF1778 domain-containing protein | - |
EB_RS05580 | 1182560..1183054 | + | 495 | WP_011236954.1 | GNAT family N-acetyltransferase | - |
EB_RS05585 | 1183254..1183568 | + | 315 | WP_011236955.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
EB_RS05590 | 1183571..1183855 | + | 285 | WP_011236956.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EB_RS05595 | 1183986..1184189 | + | 204 | WP_011236957.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
EB_RS05600 | 1184186..1184569 | + | 384 | WP_011236958.1 | twitching motility protein PilT | - |
EB_RS05605 | 1184566..1185006 | - | 441 | WP_157866582.1 | GNAT family N-acetyltransferase | - |
EB_RS05610 | 1185132..1185815 | + | 684 | Protein_1107 | IS21-like element ISAzo17 family transposase | - |
EB_RS05615 | 1186050..1187618 | + | 1569 | WP_011236587.1 | IS21 family transposase | - |
EB_RS05620 | 1187641..1188375 | + | 735 | WP_011235973.1 | IS21-like element ISAzo4 family helper ATPase IstB | - |
EB_RS05625 | 1188579..1188992 | + | 414 | Protein_1110 | IS21 family transposase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10457.10 Da Isoelectric Point: 4.6386
>T21144 WP_011236956.1 NC_006513:1183571-1183855 [Aromatoleum aromaticum EbN1]
MGIVWTEEAIGDLEEILAYYYAEAGPATAQAVEERIVAEIMALTTFPERIRTSDRVPGARELVVRRLPYVVFVKGVPDGV
VVLNVVHTARKFPE
MGIVWTEEAIGDLEEILAYYYAEAGPATAQAVEERIVAEIMALTTFPERIRTSDRVPGARELVVRRLPYVVFVKGVPDGV
VVLNVVHTARKFPE
Download Length: 285 bp
>T21144 NC_006513:1183571-1183855 [Aromatoleum aromaticum EbN1]
ATGGGGATCGTCTGGACGGAAGAGGCGATCGGCGACCTCGAAGAGATCCTCGCGTATTACTACGCCGAAGCGGGTCCGGC
AACGGCGCAGGCGGTCGAGGAACGCATCGTCGCCGAAATCATGGCGCTCACGACATTCCCCGAGAGGATCCGCACGAGCG
ACCGCGTCCCGGGCGCCCGGGAACTTGTGGTGCGACGCCTCCCATACGTGGTCTTCGTGAAAGGGGTCCCCGACGGCGTC
GTGGTGCTCAACGTGGTACACACGGCGAGGAAGTTTCCAGAGTAA
ATGGGGATCGTCTGGACGGAAGAGGCGATCGGCGACCTCGAAGAGATCCTCGCGTATTACTACGCCGAAGCGGGTCCGGC
AACGGCGCAGGCGGTCGAGGAACGCATCGTCGCCGAAATCATGGCGCTCACGACATTCCCCGAGAGGATCCGCACGAGCG
ACCGCGTCCCGGGCGCCCGGGAACTTGTGGTGCGACGCCTCCCATACGTGGTCTTCGTGAAAGGGGTCCCCGACGGCGTC
GTGGTGCTCAACGTGGTACACACGGCGAGGAAGTTTCCAGAGTAA
Antitoxin
Download Length: 68 a.a. Molecular weight: 7567.67 Da Isoelectric Point: 5.0490
>AT21144 WP_011236957.1 NC_006513:1183986-1184189 [Aromatoleum aromaticum EbN1]
MRTTVTIDDDLYEKALEVADPAMDRADLFREAMKTFVRVQAAKRLAALGGTMPEMQDVPRRRGEPSQ
MRTTVTIDDDLYEKALEVADPAMDRADLFREAMKTFVRVQAAKRLAALGGTMPEMQDVPRRRGEPSQ
Download Length: 204 bp
>AT21144 NC_006513:1183986-1184189 [Aromatoleum aromaticum EbN1]
ATGAGAACGACTGTCACGATCGATGATGATCTGTACGAAAAGGCCCTGGAAGTGGCCGATCCGGCTATGGACAGGGCCGA
TCTCTTCCGCGAGGCGATGAAAACTTTCGTTCGGGTACAAGCCGCCAAGCGCCTTGCTGCGTTGGGGGGCACCATGCCGG
AGATGCAGGATGTGCCGCGACGGCGCGGCGAGCCCTCGCAATGA
ATGAGAACGACTGTCACGATCGATGATGATCTGTACGAAAAGGCCCTGGAAGTGGCCGATCCGGCTATGGACAGGGCCGA
TCTCTTCCGCGAGGCGATGAAAACTTTCGTTCGGGTACAAGCCGCCAAGCGCCTTGCTGCGTTGGGGGGCACCATGCCGG
AGATGCAGGATGTGCCGCGACGGCGCGGCGAGCCCTCGCAATGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q5P629 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |