Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2232513..2233039 | Replicon | chromosome |
Accession | NZ_CP080247 | ||
Organism | Escherichia sp. TM-G17TGC |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | KY274_RS10785 | Protein ID | WP_000323025.1 |
Coordinates | 2232752..2233039 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | KY274_RS10780 | Protein ID | WP_000534858.1 |
Coordinates | 2232513..2232752 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KY274_RS10725 (2227540) | 2227540..2228307 | - | 768 | Protein_2094 | exonuclease | - |
KY274_RS10730 (2228400) | 2228400..2228591 | - | 192 | WP_001083297.1 | lysis protein YdfD | - |
KY274_RS10735 (2228588) | 2228588..2228776 | - | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
KY274_RS10740 (2229344) | 2229344..2229562 | - | 219 | WP_001171942.1 | protein YdfC | - |
KY274_RS22775 (2229592) | 2229592..2229720 | - | 129 | WP_000344964.1 | protein YdfB | - |
KY274_RS10745 (2229722) | 2229722..2229877 | - | 156 | WP_000379575.1 | DUF1391 family protein | - |
KY274_RS10750 (2230044) | 2230044..2230451 | - | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
KY274_RS10755 (2230535) | 2230535..2230765 | + | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
KY274_RS10760 (2230749) | 2230749..2231027 | + | 279 | Protein_2102 | hypothetical protein | - |
KY274_RS10765 (2231062) | 2231062..2231211 | + | 150 | WP_011443592.1 | protein YdfW | - |
KY274_RS10770 (2231648) | 2231648..2231980 | - | 333 | WP_001301033.1 | FlxA-like family protein | - |
KY274_RS10775 (2232183) | 2232183..2232488 | - | 306 | WP_001326990.1 | protein YdfV | - |
KY274_RS10780 (2232513) | 2232513..2232752 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
KY274_RS10785 (2232752) | 2232752..2233039 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
KY274_RS10790 (2233111) | 2233111..2233266 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
KY274_RS10795 (2233483) | 2233483..2233734 | + | 252 | WP_000980994.1 | protein Rem | - |
KY274_RS10800 (2233801) | 2233801..2234079 | + | 279 | WP_012304870.1 | hypothetical protein | - |
KY274_RS10805 (2234081) | 2234081..2235130 | + | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
KY274_RS10810 (2235144) | 2235144..2235896 | + | 753 | WP_001047135.1 | antitermination protein | - |
KY274_RS10815 (2236174) | 2236174..2236263 | - | 90 | WP_120795389.1 | hypothetical protein | - |
KY274_RS10820 (2236318) | 2236318..2236530 | - | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
KY274_RS10825 (2236831) | 2236831..2237046 | + | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
KY274_RS10830 (2237410) | 2237410..2237580 | - | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
KY274_RS10835 (2237800) | 2237800..2238015 | + | 216 | WP_000839590.1 | phage lysis protein EssD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2221641..2250033 | 28392 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T211394 WP_000323025.1 NZ_CP080247:2232752-2233039 [Escherichia sp. TM-G17TGC]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
>T211394 NZ_CP104851:2729359-2729466 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 80 a.a. Molecular weight: 9071.48 Da Isoelectric Point: 4.5230
>AT211394 WP_000534858.1 NZ_CP080247:2232513-2232752 [Escherichia sp. TM-G17TGC]
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
Download Length: 240 bp
>AT211394 NZ_CP104851:c2729312-2729246 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|