Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 814337..814863 | Replicon | chromosome |
| Accession | NZ_CP080235 | ||
| Organism | Escherichia coli O139:H1 strain W13-16 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | KZW92_RS04185 | Protein ID | WP_000323025.1 |
| Coordinates | 814337..814624 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | KZW92_RS04190 | Protein ID | WP_000534858.1 |
| Coordinates | 814624..814863 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KZW92_RS04135 (809361) | 809361..809576 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
| KZW92_RS04140 (809796) | 809796..809966 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
| KZW92_RS04145 (810330) | 810330..810545 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
| KZW92_RS04150 (810846) | 810846..811058 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
| KZW92_RS04155 (811113) | 811113..811202 | + | 90 | WP_120795389.1 | hypothetical protein | - |
| KZW92_RS04160 (811480) | 811480..812232 | - | 753 | WP_001047135.1 | antitermination protein | - |
| KZW92_RS04165 (812246) | 812246..813295 | - | 1050 | WP_063085032.1 | DUF968 domain-containing protein | - |
| KZW92_RS04170 (813297) | 813297..813575 | - | 279 | WP_012304870.1 | hypothetical protein | - |
| KZW92_RS04175 (813642) | 813642..813893 | - | 252 | WP_000980994.1 | protein Rem | - |
| KZW92_RS04180 (814110) | 814110..814265 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| KZW92_RS04185 (814337) | 814337..814624 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| KZW92_RS04190 (814624) | 814624..814863 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| KZW92_RS04195 (814888) | 814888..815193 | + | 306 | WP_001326990.1 | protein YdfV | - |
| KZW92_RS04200 (815396) | 815396..815728 | + | 333 | WP_001301033.1 | FlxA-like family protein | - |
| KZW92_RS25710 (816190) | 816190..816339 | - | 150 | WP_011443592.1 | protein YdfW | - |
| KZW92_RS04205 (816460) | 816460..817482 | - | 1023 | Protein_836 | ISNCY family transposase | - |
| KZW92_RS04210 (818272) | 818272..818559 | - | 288 | Protein_837 | hypothetical protein | - |
| KZW92_RS04215 (819037) | 819037..819526 | - | 490 | Protein_838 | class I SAM-dependent methyltransferase | - |
| KZW92_RS04220 (819523) | 819523..819663 | - | 141 | Protein_839 | DUF977 family protein | - |
| KZW92_RS04225 (819661) | 819661..819846 | - | 186 | Protein_840 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 794941..838153 | 43212 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T211315 WP_000323025.1 NZ_CP080235:c814624-814337 [Escherichia coli O139:H1]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
>T211315 NZ_CP104843:2878731-2878838 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 80 a.a. Molecular weight: 9071.48 Da Isoelectric Point: 4.5230
>AT211315 WP_000534858.1 NZ_CP080235:c814863-814624 [Escherichia coli O139:H1]
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
Download Length: 240 bp
>AT211315 NZ_CP104843:c2878681-2878624 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCCCTCAACGTGCGGGGG
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCCCTCAACGTGCGGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|