Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 2233271..2233797 | Replicon | chromosome |
| Accession | NZ_CP079924 | ||
| Organism | Escherichia sp. TC-EC600-tetX4 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | KXD89_RS10780 | Protein ID | WP_000323025.1 |
| Coordinates | 2233510..2233797 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | KXD89_RS10775 | Protein ID | WP_000534858.1 |
| Coordinates | 2233271..2233510 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KXD89_RS10720 (2228298) | 2228298..2229065 | - | 768 | Protein_2095 | exonuclease | - |
| KXD89_RS10725 (2229158) | 2229158..2229349 | - | 192 | WP_001083297.1 | lysis protein YdfD | - |
| KXD89_RS10730 (2229346) | 2229346..2229534 | - | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
| KXD89_RS10735 (2230102) | 2230102..2230320 | - | 219 | WP_001171942.1 | protein YdfC | - |
| KXD89_RS22305 (2230350) | 2230350..2230478 | - | 129 | WP_000344964.1 | protein YdfB | - |
| KXD89_RS10740 (2230480) | 2230480..2230635 | - | 156 | WP_000379575.1 | DUF1391 family protein | - |
| KXD89_RS10745 (2230802) | 2230802..2231209 | - | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
| KXD89_RS10750 (2231293) | 2231293..2231523 | + | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
| KXD89_RS10755 (2231507) | 2231507..2231785 | + | 279 | Protein_2103 | hypothetical protein | - |
| KXD89_RS10760 (2231820) | 2231820..2231969 | + | 150 | WP_011443592.1 | protein YdfW | - |
| KXD89_RS10765 (2232406) | 2232406..2232738 | - | 333 | WP_001301033.1 | FlxA-like family protein | - |
| KXD89_RS10770 (2232941) | 2232941..2233246 | - | 306 | WP_001326990.1 | protein YdfV | - |
| KXD89_RS10775 (2233271) | 2233271..2233510 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| KXD89_RS10780 (2233510) | 2233510..2233797 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| KXD89_RS10785 (2233869) | 2233869..2234024 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| KXD89_RS10790 (2234241) | 2234241..2234492 | + | 252 | WP_000980994.1 | protein Rem | - |
| KXD89_RS10795 (2234559) | 2234559..2234837 | + | 279 | WP_012304870.1 | hypothetical protein | - |
| KXD89_RS10800 (2234839) | 2234839..2235888 | + | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
| KXD89_RS10805 (2235902) | 2235902..2236654 | + | 753 | WP_001047135.1 | antitermination protein | - |
| KXD89_RS10810 (2236932) | 2236932..2237021 | - | 90 | WP_120795389.1 | hypothetical protein | - |
| KXD89_RS10815 (2237076) | 2237076..2237288 | - | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
| KXD89_RS10820 (2237589) | 2237589..2237804 | + | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
| KXD89_RS10825 (2238168) | 2238168..2238338 | - | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
| KXD89_RS10830 (2238558) | 2238558..2238773 | + | 216 | WP_000839590.1 | phage lysis protein EssD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2226435..2250791 | 24356 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T210390 WP_000323025.1 NZ_CP079924:2233510-2233797 [Escherichia sp. TC-EC600-tetX4]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
>T210390 NZ_CP104509:c4727909-4727802 [Escherichia coli]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 80 a.a. Molecular weight: 9071.48 Da Isoelectric Point: 4.5230
>AT210390 WP_000534858.1 NZ_CP079924:2233271-2233510 [Escherichia sp. TC-EC600-tetX4]
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
Download Length: 240 bp
>AT210390 NZ_CP104509:4727957-4728023 [Escherichia coli]
GGTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GGTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|