Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-DnaT |
Location | 52006..52528 | Replicon | plasmid p5ZF15-2-1 |
Accession | NZ_CP079893 | ||
Organism | Escherichia fergusonii strain 5zf15-2-1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | U9YLU1 |
Locus tag | KYD87_RS25195 | Protein ID | WP_000638823.1 |
Coordinates | 52006..52287 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | U9Y7J1 |
Locus tag | KYD87_RS25200 | Protein ID | WP_000121741.1 |
Coordinates | 52277..52528 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KYD87_RS25160 (KYD87_25020) | 48155..48475 | - | 321 | WP_000362080.1 | VirB3 family type IV secretion system protein | - |
KYD87_RS25165 | 48546..48836 | - | 291 | WP_000865479.1 | conjugal transfer protein | - |
KYD87_RS25170 (KYD87_25030) | 48836..49420 | - | 585 | WP_001177113.1 | lytic transglycosylase domain-containing protein | - |
KYD87_RS25175 (KYD87_25035) | 49441..49839 | - | 399 | WP_001153665.1 | hypothetical protein | - |
KYD87_RS25180 (KYD87_25040) | 49958..50395 | - | 438 | WP_000539665.1 | type IV pilus biogenesis protein PilM | - |
KYD87_RS25185 (KYD87_25045) | 50401..51636 | - | 1236 | WP_015059538.1 | TcpQ domain-containing protein | - |
KYD87_RS25190 (KYD87_25050) | 51639..51938 | - | 300 | WP_000835764.1 | TrbM/KikA/MpfK family conjugal transfer protein | - |
KYD87_RS25195 (KYD87_25055) | 52006..52287 | - | 282 | WP_000638823.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
KYD87_RS25200 (KYD87_25060) | 52277..52528 | - | 252 | WP_000121741.1 | hypothetical protein | Antitoxin |
KYD87_RS25205 (KYD87_25065) | 52628..53263 | - | 636 | WP_015059536.1 | hypothetical protein | - |
KYD87_RS25210 (KYD87_25070) | 53311..54102 | + | 792 | WP_023154636.1 | DUF5710 domain-containing protein | - |
KYD87_RS25215 (KYD87_25075) | 54357..54581 | - | 225 | WP_000713561.1 | EexN family lipoprotein | - |
KYD87_RS25220 (KYD87_25080) | 54590..55234 | - | 645 | WP_001310442.1 | type IV secretion system protein | - |
KYD87_RS25225 (KYD87_25085) | 55240..56235 | - | 996 | WP_001028541.1 | type IV secretion system protein | - |
KYD87_RS25230 (KYD87_25090) | 56239..56496 | - | 258 | WP_000739144.1 | hypothetical protein | - |
KYD87_RS25235 (KYD87_25095) | 56493..56795 | - | 303 | WP_001360345.1 | hypothetical protein | - |
KYD87_RS25240 (KYD87_25100) | 57066..57278 | - | 213 | WP_039022940.1 | hypothetical protein | - |
KYD87_RS25245 (KYD87_25105) | 57289..57459 | - | 171 | WP_000550720.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | mcr-1.1 | - | 1..61228 | 61228 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10945.79 Da Isoelectric Point: 10.4997
>T210355 WP_000638823.1 NZ_CP079893:c52287-52006 [Escherichia fergusonii]
MIYELAFDHRALKEWQKLGHTVREQFKKKLSERLINPRVPAAKLHGHTDRYKIKLRASGYRLVYQVIDEKVVLLVISVGK
REGSDVYHMADTR
MIYELAFDHRALKEWQKLGHTVREQFKKKLSERLINPRVPAAKLHGHTDRYKIKLRASGYRLVYQVIDEKVVLLVISVGK
REGSDVYHMADTR
Download Length: 282 bp
>T210355 NZ_CP104503:c2906186-2906079 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 84 a.a. Molecular weight: 9223.38 Da Isoelectric Point: 3.9823
>AT210355 WP_000121741.1 NZ_CP079893:c52528-52277 [Escherichia fergusonii]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPELYAYYRELAEDAELNAIADERMKNPDIVRVNL
DDL
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPELYAYYRELAEDAELNAIADERMKNPDIVRVNL
DDL
Download Length: 252 bp
>AT210355 NZ_CP104503:2906243-2906298 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|