Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
Location | 1224865..1225424 | Replicon | chromosome |
Accession | NZ_CP079860 | ||
Organism | Vibrio neptunius strain KCTC 12702 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | KW548_RS22325 | Protein ID | WP_219348750.1 |
Coordinates | 1225110..1225424 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | KW548_RS22320 | Protein ID | WP_045974123.1 |
Coordinates | 1224865..1225122 (+) | Length | 86 a.a. |
Genomic Context
Location: 1221786..1222049 (264 bp)
Type: Others
Protein ID: WP_219348745.1
Type: Others
Protein ID: WP_219348745.1
Location: 1222092..1222775 (684 bp)
Type: Others
Protein ID: WP_219348746.1
Type: Others
Protein ID: WP_219348746.1
Location: 1222841..1223254 (414 bp)
Type: Others
Protein ID: WP_219348747.1
Type: Others
Protein ID: WP_219348747.1
Location: 1223393..1223950 (558 bp)
Type: Others
Protein ID: WP_219348748.1
Type: Others
Protein ID: WP_219348748.1
Location: 1223989..1224627 (639 bp)
Type: Others
Protein ID: WP_219348749.1
Type: Others
Protein ID: WP_219348749.1
Location: 1224865..1225122 (258 bp)
Type: Antitoxin
Protein ID: WP_045974123.1
Type: Antitoxin
Protein ID: WP_045974123.1
Location: 1225110..1225424 (315 bp)
Type: Toxin
Protein ID: WP_219348750.1
Type: Toxin
Protein ID: WP_219348750.1
Location: 1225646..1226128 (483 bp)
Type: Others
Protein ID: WP_257713424.1
Type: Others
Protein ID: WP_257713424.1
Location: 1226359..1226883 (525 bp)
Type: Others
Protein ID: WP_206373393.1
Type: Others
Protein ID: WP_206373393.1
Location: 1227135..1227359 (225 bp)
Type: Others
Protein ID: WP_219349262.1
Type: Others
Protein ID: WP_219349262.1
Location: 1228001..1228135 (135 bp)
Type: Others
Protein ID: WP_257713425.1
Type: Others
Protein ID: WP_257713425.1
Location: 1228156..1228563 (408 bp)
Type: Others
Protein ID: WP_206373392.1
Type: Others
Protein ID: WP_206373392.1
Location: 1228563..1229624 (1062 bp)
Type: Others
Protein ID: WP_219348752.1
Type: Others
Protein ID: WP_219348752.1
Location: 1220359..1220640 (282 bp)
Type: Others
Protein ID: WP_257713423.1
Type: Others
Protein ID: WP_257713423.1
Location: 1220983..1221273 (291 bp)
Type: Others
Protein ID: WP_206372260.1
Type: Others
Protein ID: WP_206372260.1
Location: 1221263..1221511 (249 bp)
Type: Others
Protein ID: WP_206372259.1
Type: Others
Protein ID: WP_206372259.1
Location: 1221594..1221741 (148 bp)
Type: Others
Protein ID: Protein_1159
Type: Others
Protein ID: Protein_1159
Location: 1227406..1227703 (298 bp)
Type: Others
Protein ID: Protein_1170
Type: Others
Protein ID: Protein_1170
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KW548_RS22275 (KW548_22280) | 1220359..1220640 | - | 282 | WP_257713423.1 | hypothetical protein | - |
KW548_RS22280 (KW548_22285) | 1220983..1221273 | - | 291 | WP_206372260.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
KW548_RS22285 (KW548_22290) | 1221263..1221511 | - | 249 | WP_206372259.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
KW548_RS22290 (KW548_22295) | 1221594..1221741 | - | 148 | Protein_1159 | IS110 family transposase | - |
KW548_RS22295 (KW548_22300) | 1221786..1222049 | + | 264 | WP_219348745.1 | hypothetical protein | - |
KW548_RS22300 (KW548_22305) | 1222092..1222775 | + | 684 | WP_219348746.1 | SDR family oxidoreductase | - |
KW548_RS22305 (KW548_22310) | 1222841..1223254 | + | 414 | WP_219348747.1 | GFA family protein | - |
KW548_RS22310 (KW548_22315) | 1223393..1223950 | + | 558 | WP_219348748.1 | nucleotidyltransferase family protein | - |
KW548_RS22315 (KW548_22320) | 1223989..1224627 | + | 639 | WP_219348749.1 | HAD hydrolase-like protein | - |
KW548_RS22320 (KW548_22325) | 1224865..1225122 | + | 258 | WP_045974123.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
KW548_RS22325 (KW548_22330) | 1225110..1225424 | + | 315 | WP_219348750.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
KW548_RS22330 (KW548_22335) | 1225646..1226128 | + | 483 | WP_257713424.1 | hypothetical protein | - |
KW548_RS22335 (KW548_22340) | 1226359..1226883 | + | 525 | WP_206373393.1 | DinB family protein | - |
KW548_RS22340 (KW548_22345) | 1227135..1227359 | + | 225 | WP_219349262.1 | hypothetical protein | - |
KW548_RS22345 (KW548_22350) | 1227406..1227703 | - | 298 | Protein_1170 | transposase | - |
KW548_RS25515 | 1228001..1228135 | + | 135 | WP_257713425.1 | hypothetical protein | - |
KW548_RS22350 (KW548_22355) | 1228156..1228563 | + | 408 | WP_206373392.1 | hypothetical protein | - |
KW548_RS22355 (KW548_22360) | 1228563..1229624 | + | 1062 | WP_219348752.1 | ABC transporter transmembrane domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11957.97 Da Isoelectric Point: 5.2080
>T210252 WP_219348750.1 NZ_CP079860:1225110-1225424 [Vibrio neptunius]
MAEIIWTEPALSDLNDIAEYIALENIVAAKELVQAIFSKVERLEAFPESGRIPPKLEHLSYREVVVNPCRIFYKQDGDKV
FILFVMRSERDLRKFLLSKLGMSG
MAEIIWTEPALSDLNDIAEYIALENIVAAKELVQAIFSKVERLEAFPESGRIPPKLEHLSYREVVVNPCRIFYKQDGDKV
FILFVMRSERDLRKFLLSKLGMSG
Download Length: 315 bp
>T210252 NZ_CP104479:c4231868-4231560 [Salmonella enterica]
ATGCAATACATGGTTTATCGCAATAAAGGAAACAGCAAGGCTTATCCTTATTTACTTGATGTGCAAAGCGATATTATTGA
TGAATTGCATACTCGCATGGTTATCCCATTGTTTCCTGTGAGCAGATTGGTAAATAACCCAGTTAAGCGCCTCACGCCCA
CTCTGAATGTGGAAGGTAATGACTATCTGGTGATGACTCACGAAATGGCGAGTATCAGGCTTTCGCAGATTGGTGATGAG
GTGATGGACGTTCGTTCCCACAGGCAAACCATCAAAAATGCTCTCGATTTTATCTTTGACGGGTTCTGA
ATGCAATACATGGTTTATCGCAATAAAGGAAACAGCAAGGCTTATCCTTATTTACTTGATGTGCAAAGCGATATTATTGA
TGAATTGCATACTCGCATGGTTATCCCATTGTTTCCTGTGAGCAGATTGGTAAATAACCCAGTTAAGCGCCTCACGCCCA
CTCTGAATGTGGAAGGTAATGACTATCTGGTGATGACTCACGAAATGGCGAGTATCAGGCTTTCGCAGATTGGTGATGAG
GTGATGGACGTTCGTTCCCACAGGCAAACCATCAAAAATGCTCTCGATTTTATCTTTGACGGGTTCTGA
Antitoxin
Download Length: 86 a.a. Molecular weight: 9620.12 Da Isoelectric Point: 6.7273
>AT210252 WP_045974123.1 NZ_CP079860:1224865-1225122 [Vibrio neptunius]
MKVELVTSLKRQATKILADLHETKEPVLITEHGKPSAYLVDVDDYEFMQNRLAILEGIARGERALADGKVVSHDEAKDKM
SKWLK
MKVELVTSLKRQATKILADLHETKEPVLITEHGKPSAYLVDVDDYEFMQNRLAILEGIARGERALADGKVVSHDEAKDKM
SKWLK
Download Length: 258 bp
>AT210252 NZ_CP104479:c4232110-4231871 [Salmonella enterica]
ATGTCGGGTATGAGTGTACGACATAAAAAAACAGTCAGTGTCACGCTGGAACCTGCATTGCTTCAGCAAGCCCGTGATGC
AGGTATTAATCTGTCTGCGGTGCTTACCGCCGCGCTGAAAGAGGAAATCAGTGCCACAGGCGTTGAACGCTGGAAAGCAG
AAAATAGAGCGGGTTTGCAGGAGCTCAATCGTATTACTGATGAGCACGGCCTTTTATCGGACGATTACAGGACGTTTTAA
ATGTCGGGTATGAGTGTACGACATAAAAAAACAGTCAGTGTCACGCTGGAACCTGCATTGCTTCAGCAAGCCCGTGATGC
AGGTATTAATCTGTCTGCGGTGCTTACCGCCGCGCTGAAAGAGGAAATCAGTGCCACAGGCGTTGAACGCTGGAAAGCAG
AAAATAGAGCGGGTTTGCAGGAGCTCAATCGTATTACTGATGAGCACGGCCTTTTATCGGACGATTACAGGACGTTTTAA