Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
| Location | 6356499..6357217 | Replicon | chromosome |
| Accession | NZ_CP078145 | ||
| Organism | Nocardia iowensis strain NRRL 5646 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | KV110_RS29300 | Protein ID | WP_218470442.1 |
| Coordinates | 6356499..6356924 (-) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | KV110_RS29305 | Protein ID | WP_246634058.1 |
| Coordinates | 6356921..6357217 (-) | Length | 99 a.a. |
Genomic Context
Location: 6351514..6352929 (1416 bp)
Type: Others
Protein ID: WP_218470438.1
Type: Others
Protein ID: WP_218470438.1
Location: 6355677..6356498 (822 bp)
Type: Others
Protein ID: WP_218470441.1
Type: Others
Protein ID: WP_218470441.1
Location: 6357761..6358189 (429 bp)
Type: Others
Protein ID: WP_218470444.1
Type: Others
Protein ID: WP_218470444.1
Location: 6361449..6361676 (228 bp)
Type: Others
Protein ID: WP_246634060.1
Type: Others
Protein ID: WP_246634060.1
Location: 6353802..6354311 (510 bp)
Type: Others
Protein ID: WP_218470439.1
Type: Others
Protein ID: WP_218470439.1
Location: 6354796..6355542 (747 bp)
Type: Others
Protein ID: WP_218470440.1
Type: Others
Protein ID: WP_218470440.1
Location: 6356499..6356924 (426 bp)
Type: Toxin
Protein ID: WP_218470442.1
Type: Toxin
Protein ID: WP_218470442.1
Location: 6356921..6357217 (297 bp)
Type: Antitoxin
Protein ID: WP_246634058.1
Type: Antitoxin
Protein ID: WP_246634058.1
Location: 6357247..6357669 (423 bp)
Type: Others
Protein ID: WP_218470443.1
Type: Others
Protein ID: WP_218470443.1
Location: 6358213..6359097 (885 bp)
Type: Others
Protein ID: WP_218470445.1
Type: Others
Protein ID: WP_218470445.1
Location: 6359265..6360377 (1113 bp)
Type: Others
Protein ID: WP_218470446.1
Type: Others
Protein ID: WP_218470446.1
Location: 6360432..6361463 (1032 bp)
Type: Others
Protein ID: WP_246634059.1
Type: Others
Protein ID: WP_246634059.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KV110_RS29280 (KV110_29280) | 6351514..6352929 | + | 1416 | WP_218470438.1 | FAD-dependent oxidoreductase | - |
| KV110_RS29285 (KV110_29285) | 6353802..6354311 | - | 510 | WP_218470439.1 | hypothetical protein | - |
| KV110_RS29290 (KV110_29290) | 6354796..6355542 | - | 747 | WP_218470440.1 | 4-hydroxy-tetrahydrodipicolinate reductase | - |
| KV110_RS29295 (KV110_29295) | 6355677..6356498 | + | 822 | WP_218470441.1 | alpha/beta hydrolase | - |
| KV110_RS29300 (KV110_29300) | 6356499..6356924 | - | 426 | WP_218470442.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| KV110_RS29305 (KV110_29305) | 6356921..6357217 | - | 297 | WP_246634058.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| KV110_RS29310 (KV110_29310) | 6357247..6357669 | - | 423 | WP_218470443.1 | MarR family transcriptional regulator | - |
| KV110_RS29315 (KV110_29315) | 6357761..6358189 | + | 429 | WP_218470444.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| KV110_RS29320 (KV110_29320) | 6358213..6359097 | - | 885 | WP_218470445.1 | NAD(P)-binding domain-containing protein | - |
| KV110_RS29325 (KV110_29325) | 6359265..6360377 | - | 1113 | WP_218470446.1 | alcohol dehydrogenase catalytic domain-containing protein | - |
| KV110_RS29330 (KV110_29330) | 6360432..6361463 | - | 1032 | WP_246634059.1 | DUF418 domain-containing protein | - |
| KV110_RS41670 | 6361449..6361676 | + | 228 | WP_246634060.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15553.73 Da Isoelectric Point: 6.6428
>T209124 WP_218470442.1 NZ_CP078145:c6356924-6356499 [Nocardia iowensis]
VRNYLLDTSAVSEWVKPRPDPGLTQWLHTTDEDRLHLSVITLGEIRKGIEKMPDSPKKRRLVEWLTESLIDRFEGRLLSV
DATVAQAWGRMVARTEGNGNPVEPADALIAATAVSHGLEVVTRNVGHFGPTGVAIVCPWHG
VRNYLLDTSAVSEWVKPRPDPGLTQWLHTTDEDRLHLSVITLGEIRKGIEKMPDSPKKRRLVEWLTESLIDRFEGRLLSV
DATVAQAWGRMVARTEGNGNPVEPADALIAATAVSHGLEVVTRNVGHFGPTGVAIVCPWHG
Download Length: 426 bp
>T209124 NZ_CP103856:c2302015-2301836 [Bacillus velezensis]
GTGCTTGAGAAAGTGGGTATAACAATTGCTTTCCTTATTCCTATCACGGTTTTAATCATCAACTGTTTAACGATAGCTGA
GAAGATTCAAAACCTGATGAAGAATAAAGAAAGCAAAAAGAAAAAGCGTACACGCAAGCGCCTCCGTAGCAAGAGACAAC
GCAAACGTATACGCAGATAA
GTGCTTGAGAAAGTGGGTATAACAATTGCTTTCCTTATTCCTATCACGGTTTTAATCATCAACTGTTTAACGATAGCTGA
GAAGATTCAAAACCTGATGAAGAATAAAGAAAGCAAAAAGAAAAAGCGTACACGCAAGCGCCTCCGTAGCAAGAGACAAC
GCAAACGTATACGCAGATAA
Antitoxin
Download Length: 99 a.a. Molecular weight: 11075.54 Da Isoelectric Point: 4.9502
>AT209124 WP_246634058.1 NZ_CP078145:c6357217-6356921 [Nocardia iowensis]
VVETGDQMARKRSERPDVAWPLADAKARLSELIDIVEREGPQVISKHGREVAVVVPIDEWRQKTSRQGSLAEFFAASPLR
DSGVEIERIHMDVRDVEL
VVETGDQMARKRSERPDVAWPLADAKARLSELIDIVEREGPQVISKHGREVAVVVPIDEWRQKTSRQGSLAEFFAASPLR
DSGVEIERIHMDVRDVEL
Download Length: 297 bp
>AT209124 NZ_CP103856:2301962-2302048 [Bacillus velezensis]
TAAAACCGTGATAGGAATAAGGAAAGCAATTGTTATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTATAACTC
TATTATA
TAAAACCGTGATAGGAATAAGGAAAGCAATTGTTATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTATAACTC
TATTATA