Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1814455..1815070 | Replicon | chromosome |
Accession | NZ_CP077082 | ||
Organism | Pseudomonas sp. OE 28.3 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0W0I427 |
Locus tag | HU759_RS08150 | Protein ID | WP_017736377.1 |
Coordinates | 1814888..1815070 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | HU759_RS08145 | Protein ID | WP_186617453.1 |
Coordinates | 1814455..1814865 (-) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HU759_RS08100 (HU759_008100) | 1809654..1809938 | - | 285 | WP_017137286.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
HU759_RS08105 (HU759_008105) | 1809928..1810167 | - | 240 | WP_017137287.1 | ribbon-helix-helix protein, CopG family | - |
HU759_RS08110 (HU759_008110) | 1810269..1810679 | + | 411 | WP_017137288.1 | fosfomycin resistance glutathione transferase | - |
HU759_RS08115 (HU759_008115) | 1810734..1811375 | + | 642 | WP_169985477.1 | LysE family translocator | - |
HU759_RS08120 (HU759_008120) | 1811495..1812022 | + | 528 | WP_017137290.1 | DUF4142 domain-containing protein | - |
HU759_RS08125 (HU759_008125) | 1812077..1812502 | - | 426 | WP_017137291.1 | low affinity iron permease family protein | - |
HU759_RS08130 (HU759_008130) | 1812684..1813466 | + | 783 | WP_017137292.1 | GNAT family N-acetyltransferase | - |
HU759_RS08135 (HU759_008135) | 1813467..1813967 | - | 501 | WP_017137293.1 | methylated-DNA--[protein]-cysteine S-methyltransferase | - |
HU759_RS08140 (HU759_008140) | 1814056..1814379 | - | 324 | WP_017137294.1 | hypothetical protein | - |
HU759_RS08145 (HU759_008145) | 1814455..1814865 | - | 411 | WP_186617453.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
HU759_RS08150 (HU759_008150) | 1814888..1815070 | - | 183 | WP_017736377.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
HU759_RS08155 (HU759_008155) | 1815238..1816131 | - | 894 | WP_099548620.1 | LysR family transcriptional regulator | - |
HU759_RS08160 (HU759_008160) | 1816227..1817390 | + | 1164 | WP_017137298.1 | MFS transporter | - |
HU759_RS08165 (HU759_008165) | 1817387..1818586 | + | 1200 | WP_186617455.1 | MFS transporter | - |
HU759_RS08170 (HU759_008170) | 1818571..1818879 | - | 309 | WP_017137300.1 | putative addiction module antidote protein | - |
HU759_RS08175 (HU759_008175) | 1818882..1819175 | - | 294 | WP_026013719.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
HU759_RS08180 (HU759_008180) | 1819640..1819879 | + | 240 | WP_017137302.1 | DUF6124 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1809928..1830611 | 20683 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6791.96 Da Isoelectric Point: 10.7532
>T206663 WP_017736377.1 NZ_CP077082:c1815070-1814888 [Pseudomonas sp. OE 28.3]
VDSRYLIGHIVADGWYLVRTRGSHHHFKHPTKPGLVTIPHPKKDLLDKTAKSILKQALLS
VDSRYLIGHIVADGWYLVRTRGSHHHFKHPTKPGLVTIPHPKKDLLDKTAKSILKQALLS
Download Length: 183 bp
>T206663 NZ_CP102552:1966113-1966215 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 137 a.a. Molecular weight: 14886.79 Da Isoelectric Point: 4.2835
>AT206663 WP_186617453.1 NZ_CP077082:c1814865-1814455 [Pseudomonas sp. OE 28.3]
MLYPIAISTGDEDHAWGVEVPDIPGCYSAGDDLDDAMAMAREAIEGHFEILAEDGAPIPTAQKVTLHAANPEYADCIWAV
VDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEEKSRSGFLASAALKVLQQEH
MLYPIAISTGDEDHAWGVEVPDIPGCYSAGDDLDDAMAMAREAIEGHFEILAEDGAPIPTAQKVTLHAANPEYADCIWAV
VDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEEKSRSGFLASAALKVLQQEH
Download Length: 411 bp
>AT206663 NZ_CP102552:c1966222-1966077 [Klebsiella pneumoniae]
TAAAGATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAG
TTGGCATTAATGCAGGCTAAGTCGCCTTGCACTATAAGAATAGTTTAACGCGTCAGCTTTTCCAGT
TAAAGATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAG
TTGGCATTAATGCAGGCTAAGTCGCCTTGCACTATAAGAATAGTTTAACGCGTCAGCTTTTCCAGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|