Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 241249..241891 | Replicon | chromosome |
Accession | NZ_CP076146 | ||
Organism | Bacillus anthracis strain BUL 40 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | J8CWW5 |
Locus tag | KM401_RS01340 | Protein ID | WP_000635963.1 |
Coordinates | 241541..241891 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | R8I8H2 |
Locus tag | KM401_RS01335 | Protein ID | WP_000004570.1 |
Coordinates | 241249..241536 (+) | Length | 96 a.a. |
Genomic Context
Location: 236565..237527 (963 bp)
Type: Others
Protein ID: WP_000961037.1
Type: Others
Protein ID: WP_000961037.1
Location: 238185..238544 (360 bp)
Type: Others
Protein ID: WP_000635040.1
Type: Others
Protein ID: WP_000635040.1
Location: 238701..239651 (951 bp)
Type: Others
Protein ID: WP_025388382.1
Type: Others
Protein ID: WP_025388382.1
Location: 239770..240939 (1170 bp)
Type: Others
Protein ID: WP_000390596.1
Type: Others
Protein ID: WP_000390596.1
Location: 241249..241536 (288 bp)
Type: Antitoxin
Protein ID: WP_000004570.1
Type: Antitoxin
Protein ID: WP_000004570.1
Location: 241541..241891 (351 bp)
Type: Toxin
Protein ID: WP_000635963.1
Type: Toxin
Protein ID: WP_000635963.1
Location: 241959..244127 (2169 bp)
Type: Others
Protein ID: WP_000426225.1
Type: Others
Protein ID: WP_000426225.1
Location: 244497..244955 (459 bp)
Type: Others
Protein ID: WP_000344248.1
Type: Others
Protein ID: WP_000344248.1
Location: 237520..238092 (573 bp)
Type: Others
Protein ID: WP_000906916.1
Type: Others
Protein ID: WP_000906916.1
Location: 244185..244301 (117 bp)
Type: Others
Protein ID: WP_001143642.1
Type: Others
Protein ID: WP_001143642.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KM401_RS01310 (KM401_01310) | 236565..237527 | + | 963 | WP_000961037.1 | UV DNA damage repair endonuclease UvsE | - |
KM401_RS01315 (KM401_01315) | 237520..238092 | - | 573 | WP_000906916.1 | rhomboid family intramembrane serine protease | - |
KM401_RS01320 (KM401_01320) | 238185..238544 | + | 360 | WP_000635040.1 | holo-ACP synthase | - |
KM401_RS01325 (KM401_01325) | 238701..239651 | + | 951 | WP_025388382.1 | outer membrane lipoprotein carrier protein LolA | - |
KM401_RS01330 (KM401_01330) | 239770..240939 | + | 1170 | WP_000390596.1 | alanine racemase | - |
KM401_RS01335 (KM401_01335) | 241249..241536 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
KM401_RS01340 (KM401_01340) | 241541..241891 | + | 351 | WP_000635963.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
KM401_RS01345 (KM401_01345) | 241959..244127 | + | 2169 | WP_000426225.1 | Tex family protein | - |
KM401_RS01350 (KM401_01350) | 244185..244301 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
KM401_RS01355 (KM401_01355) | 244497..244955 | + | 459 | WP_000344248.1 | SprT family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12974.12 Da Isoelectric Point: 5.7168
>T204706 WP_000635963.1 NZ_CP076146:241541-241891 [Bacillus anthracis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
Download Length: 351 bp
>T204706 NZ_CP101222:c2038409-2038302 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACTTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACTTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 96 a.a. Molecular weight: 10780.36 Da Isoelectric Point: 8.9605
>AT204706 WP_000004570.1 NZ_CP076146:241249-241536 [Bacillus anthracis]
VSESSVTTEIVVRLPKQMVTELDGIGKQENKNRHELICQATQLLLRQHKTKKRYQHESMRRGYIEMGKINLGIASEAFLA
EYEAAHTVERLVSGG
VSESSVTTEIVVRLPKQMVTELDGIGKQENKNRHELICQATQLLLRQHKTKKRYQHESMRRGYIEMGKINLGIASEAFLA
EYEAAHTVERLVSGG
Download Length: 288 bp
>AT204706 NZ_CP101222:2038457-2038523 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC