Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-yefM/YoeB-YefM |
| Location | 7035469..7035983 | Replicon | chromosome |
| Accession | NZ_CP073721 | ||
| Organism | Dactylosporangium roseum strain NRRL B-16295 | ||
Toxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | Drose_RS33010 | Protein ID | WP_260725167.1 |
| Coordinates | 7035723..7035983 (+) | Length | 87 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | - |
| Locus tag | Drose_RS33005 | Protein ID | WP_260725166.1 |
| Coordinates | 7035469..7035726 (+) | Length | 86 a.a. |
Genomic Context
Location: 7034306..7034599 (294 bp)
Type: Others
Protein ID: WP_259859533.1
Type: Others
Protein ID: WP_259859533.1
Location: 7034604..7035092 (489 bp)
Type: Others
Protein ID: WP_260725165.1
Type: Others
Protein ID: WP_260725165.1
Location: 7035469..7035726 (258 bp)
Type: Antitoxin
Protein ID: WP_260725166.1
Type: Antitoxin
Protein ID: WP_260725166.1
Location: 7035723..7035983 (261 bp)
Type: Toxin
Protein ID: WP_260725167.1
Type: Toxin
Protein ID: WP_260725167.1
Location: 7036561..7036782 (222 bp)
Type: Others
Protein ID: WP_260725168.1
Type: Others
Protein ID: WP_260725168.1
Location: 7037863..7038585 (723 bp)
Type: Others
Protein ID: WP_260729897.1
Type: Others
Protein ID: WP_260729897.1
Location: 7039660..7040442 (783 bp)
Type: Others
Protein ID: WP_260725170.1
Type: Others
Protein ID: WP_260725170.1
Location: 7030780..7031541 (762 bp)
Type: Others
Protein ID: Protein_6537
Type: Others
Protein ID: Protein_6537
Location: 7031973..7034201 (2229 bp)
Type: Others
Protein ID: WP_260725164.1
Type: Others
Protein ID: WP_260725164.1
Location: 7038837..7039391 (555 bp)
Type: Others
Protein ID: WP_260725169.1
Type: Others
Protein ID: WP_260725169.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Drose_RS32985 | 7030780..7031541 | - | 762 | Protein_6537 | glycosyltransferase 87 family protein | - |
| Drose_RS32990 (Drose_32745) | 7031973..7034201 | - | 2229 | WP_260725164.1 | EAL domain-containing protein | - |
| Drose_RS32995 (Drose_32750) | 7034306..7034599 | + | 294 | WP_259859533.1 | metal-sensitive transcriptional regulator | - |
| Drose_RS33000 (Drose_32755) | 7034604..7035092 | + | 489 | WP_260725165.1 | hypothetical protein | - |
| Drose_RS33005 (Drose_32760) | 7035469..7035726 | + | 258 | WP_260725166.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| Drose_RS33010 (Drose_32765) | 7035723..7035983 | + | 261 | WP_260725167.1 | Txe/YoeB family addiction module toxin | Toxin |
| Drose_RS33015 (Drose_32770) | 7036561..7036782 | + | 222 | WP_260725168.1 | hypothetical protein | - |
| Drose_RS33020 (Drose_32775) | 7037863..7038585 | + | 723 | WP_260729897.1 | site-specific integrase | - |
| Drose_RS33030 (Drose_32785) | 7038837..7039391 | - | 555 | WP_260725169.1 | YqgE/AlgH family protein | - |
| Drose_RS33035 (Drose_32790) | 7039660..7040442 | + | 783 | WP_260725170.1 | S-methyl-5'-thioadenosine phosphorylase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10187.58 Da Isoelectric Point: 8.8832
>T200131 WP_260725167.1 NZ_CP073721:7035723-7035983 [Dactylosporangium roseum]
VKLSWTDLAWDDYLYWQTQDRKTLRRINALIADIKRDPDGPGIGKPELLRNNLAGLRSRRIDDEHRLVYAVTPDEVTIIS
CRYRYQ
VKLSWTDLAWDDYLYWQTQDRKTLRRINALIADIKRDPDGPGIGKPELLRNNLAGLRSRRIDDEHRLVYAVTPDEVTIIS
CRYRYQ
Download Length: 261 bp
>T200131 NZ_CP097716:225451-225558 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 86 a.a. Molecular weight: 9465.55 Da Isoelectric Point: 4.7628
>AT200131 WP_260725166.1 NZ_CP073721:7035469-7035726 [Dactylosporangium roseum]
MTQAISASEARKSLFPLIEQVNNDHTPIEIVSKRGNAVLVSKEDWDAIVETNYLLRSPANAKHLMASVEQWRSGQATERD
LDSDA
MTQAISASEARKSLFPLIEQVNNDHTPIEIVSKRGNAVLVSKEDWDAIVETNYLLRSPANAKHLMASVEQWRSGQATERD
LDSDA
Download Length: 258 bp
>AT200131 NZ_CP097716:c225394-225339 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT