199604

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/ElaA-DUF1778
Location 1..79816 Replicon plasmid pkle02
Accession NZ_CP073237
Organism Klebsiella pasteurii strain Sb-24

Toxin (Protein)


Gene name tacT Uniprot ID A0A5E1AVR5
Locus tag KCG39_RS27240 Protein ID WP_013087172.1
Coordinates 1..486 (+) Length 162 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID A0A5E1AWX8
Locus tag KCG39_RS27235 Protein ID WP_012540086.1
Coordinates 79816..13 (+) Length -26600.666666667 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KCG39_RS27240 (KCG39_27240) 1..486 + 486 WP_013087172.1 GNAT family N-acetyltransferase Toxin
KCG39_RS27845 769..921 + 153 Protein_2 DUF5431 family protein -
KCG39_RS27245 (KCG39_27245) 866..988 + 123 WP_085842394.1 Hok/Gef family protein -
KCG39_RS27250 (KCG39_27250) 1366..1635 + 270 WP_038807148.1 hypothetical protein -
KCG39_RS27255 (KCG39_27255) 1632..1982 + 351 WP_063106385.1 hypothetical protein -
KCG39_RS27260 (KCG39_27260) 1997..2314 + 318 WP_038807150.1 hypothetical protein -
KCG39_RS27850 2953..3198 + 246 WP_074155869.1 hypothetical protein -
KCG39_RS27265 (KCG39_27265) 3185..3403 + 219 Protein_8 hypothetical protein -
KCG39_RS27270 (KCG39_27270) 3406..3828 + 423 Protein_9 TraX family protein -
KCG39_RS27275 (KCG39_27275) 3984..4577 + 594 WP_049141667.1 fertility inhibition protein FinO -
KCG39_RS27280 (KCG39_27280) 5254..5898 + 645 WP_211811642.1 hypothetical protein -
KCG39_RS27285 (KCG39_27285) 5954..6604 + 651 WP_211811643.1 DUF2726 domain-containing protein -
KCG39_RS27290 (KCG39_27290) 6601..6909 + 309 WP_211811644.1 hypothetical protein -
KCG39_RS27295 (KCG39_27295) 7009..7560 + 552 WP_266098453.1 phospholipase D family protein -
KCG39_RS27300 (KCG39_27300) 7693..7953 + 261 WP_075211167.1 replication regulatory protein RepA -
KCG39_RS27305 (KCG39_27305) 8179..8256 + 78 WP_071846032.1 RepA leader peptide Tap -
KCG39_RS27310 (KCG39_27310) 8249..9274 + 1026 WP_211811645.1 plasmid replication initiator RepA -
KCG39_RS27315 (KCG39_27315) 10337..11488 + 1152 WP_075912867.1 tail fiber domain-containing protein -
KCG39_RS27320 (KCG39_27320) 11492..13627 + 2136 WP_211811646.1 S-type pyocin domain-containing protein -
KCG39_RS27325 (KCG39_27325) 13624..13890 + 267 WP_211811647.1 colicin immunity domain-containing protein -
KCG39_RS27330 (KCG39_27330) 14270..14761 + 492 Protein_21 Tn3 family transposase -
KCG39_RS27335 (KCG39_27335) 14997..16217 + 1221 WP_211811648.1 ISL3 family transposase -
KCG39_RS27340 (KCG39_27340) 16514..17065 + 552 WP_211811649.1 hypothetical protein -
KCG39_RS27345 (KCG39_27345) 17363..17827 + 465 WP_211811650.1 hypothetical protein -
KCG39_RS27350 (KCG39_27350) 17799..18218 + 420 WP_211811651.1 hypothetical protein -
KCG39_RS27355 (KCG39_27355) 18280..18525 - 246 WP_211811652.1 GrxA family glutaredoxin -
KCG39_RS27360 (KCG39_27360) 18537..18782 - 246 WP_211811653.1 hypothetical protein -
KCG39_RS27365 (KCG39_27365) 18803..18997 - 195 WP_211811654.1 hypothetical protein -
KCG39_RS27370 (KCG39_27370) 19077..19787 - 711 WP_211811655.1 hypothetical protein -
KCG39_RS27375 (KCG39_27375) 19887..20361 - 475 Protein_30 transposase -
KCG39_RS27380 (KCG39_27380) 20476..20823 - 348 WP_142884384.1 hypothetical protein -
KCG39_RS27385 (KCG39_27385) 21046..21363 + 318 Protein_32 AraC family transcriptional regulator -
KCG39_RS27395 (KCG39_27395) 23023..23886 - 864 WP_211811656.1 hypothetical protein -
KCG39_RS27400 (KCG39_27400) 23970..24497 - 528 WP_211811657.1 GNAT family N-acetyltransferase -
KCG39_RS27405 (KCG39_27405) 24505..24774 - 270 WP_048264996.1 DUF1778 domain-containing protein -
KCG39_RS27860 25250..25339 + 90 Protein_37 transposase -
KCG39_RS27410 (KCG39_27410) 25349..25777 - 429 Protein_38 transposase -
KCG39_RS27415 (KCG39_27415) 26041..26523 + 483 Protein_39 integrase core domain-containing protein -
KCG39_RS27420 (KCG39_27420) 26968..28078 + 1111 Protein_40 IS3 family transposase -
KCG39_RS27425 (KCG39_27425) 28268..29284 - 1017 WP_211811658.1 hypothetical protein -
KCG39_RS27430 (KCG39_27430) 29911..30444 - 534 WP_211811659.1 fimbrial protein -
KCG39_RS27435 (KCG39_27435) 30461..30979 - 519 WP_211811660.1 fimbrial protein -
KCG39_RS27440 (KCG39_27440) 30976..31494 - 519 WP_228299446.1 fimbrial protein -
KCG39_RS27445 (KCG39_27445) 31503..32099 - 597 WP_228299447.1 fimbrial protein -
KCG39_RS27450 (KCG39_27450) 32147..32875 - 729 WP_211811666.1 fimbria/pilus periplasmic chaperone -
KCG39_RS27455 (KCG39_27455) 33031..35547 - 2517 WP_211811667.1 outer membrane usher protein -
KCG39_RS27460 (KCG39_27460) 35902..36066 - 165 WP_211811662.1 hypothetical protein -
KCG39_RS27465 (KCG39_27465) 36222..36755 - 534 WP_211811663.1 fimbrial protein -
KCG39_RS27470 (KCG39_27470) 37218..37676 - 459 Protein_50 IS3 family transposase -
KCG39_RS27475 (KCG39_27475) 37757..39265 - 1509 WP_211811668.1 group II intron reverse transcriptase/maturase -
KCG39_RS27480 (KCG39_27480) 39938..40623 - 686 Protein_52 IS3 family transposase -
KCG39_RS27485 (KCG39_27485) 40812..41780 + 969 WP_211811630.1 IS110 family transposase -
KCG39_RS27490 (KCG39_27490) 42045..42329 - 285 WP_211811631.1 hypothetical protein -
KCG39_RS27495 (KCG39_27495) 42507..43070 - 564 WP_211811632.1 helix-turn-helix transcriptional regulator -
KCG39_RS27500 (KCG39_27500) 43960..44523 + 564 WP_211811633.1 helix-turn-helix transcriptional regulator -
KCG39_RS27505 (KCG39_27505) 44598..45092 - 495 WP_211811634.1 hypothetical protein -
KCG39_RS27510 (KCG39_27510) 45076..45858 - 783 WP_211811635.1 helix-turn-helix domain-containing protein -
KCG39_RS27520 (KCG39_27520) 47936..48676 + 741 WP_001515717.1 tyrosine-type recombinase/integrase -
KCG39_RS27525 (KCG39_27525) 49459..50469 - 1011 WP_032740675.1 RepB family plasmid replication initiator protein -
KCG39_RS27530 (KCG39_27530) 51211..52377 + 1167 WP_000523815.1 plasmid-partitioning protein SopA -
KCG39_RS27535 (KCG39_27535) 52377..53342 + 966 WP_032740676.1 ParB/RepB/Spo0J family plasmid partition protein -
KCG39_RS27540 (KCG39_27540) 54698..55072 - 375 WP_074446765.1 fluoride efflux transporter CrcB -
KCG39_RS27545 (KCG39_27545) 55169..56458 - 1290 WP_032740678.1 phosphopyruvate hydratase -
KCG39_RS27550 (KCG39_27550) 56475..56900 - 426 WP_032740679.1 universal stress protein -
KCG39_RS27555 (KCG39_27555) 56903..57805 - 903 WP_040107984.1 DHH family phosphoesterase -
KCG39_RS27865 58264..58494 + 231 WP_032740680.1 hypothetical protein -
KCG39_RS27560 (KCG39_27560) 58885..59181 - 297 WP_211811637.1 hypothetical protein -
KCG39_RS27565 (KCG39_27565) 59592..61163 + 1572 WP_049010905.1 sensor domain-containing diguanylate cyclase -
KCG39_RS27870 61179..61343 + 165 Protein_71 hypothetical protein -
KCG39_RS27570 (KCG39_27570) 61792..62220 + 429 WP_211811638.1 antirestriction protein -
KCG39_RS27575 (KCG39_27575) 62265..62771 + 507 WP_046622857.1 antirestriction protein ArdA -
KCG39_RS27580 (KCG39_27580) 62814..63005 + 192 WP_049010907.1 hypothetical protein -
KCG39_RS27585 (KCG39_27585) 63206..63460 + 255 WP_165454128.1 DNA polymerase III subunit theta -
KCG39_RS27590 (KCG39_27590) 63495..63815 + 321 WP_049010910.1 hypothetical protein -
KCG39_RS27875 64266..64469 + 204 WP_071592596.1 hypothetical protein -
KCG39_RS27595 (KCG39_27595) 64500..65042 + 543 WP_064402442.1 single-stranded DNA-binding protein -
KCG39_RS27600 (KCG39_27600) 65091..65339 + 249 WP_211811639.1 DUF905 domain-containing protein -
KCG39_RS27605 (KCG39_27605) 65408..67408 + 2001 WP_211811640.1 ParB/RepB/Spo0J family partition protein -
KCG39_RS27610 (KCG39_27610) 67453..67884 + 432 WP_130940021.1 conjugation system SOS inhibitor PsiB -
KCG39_RS27615 (KCG39_27615) 67881..68609 + 729 WP_040107916.1 plasmid SOS inhibition protein A -
KCG39_RS27620 (KCG39_27620) 68606..68932 + 327 WP_038992719.1 hypothetical protein -
KCG39_RS27625 (KCG39_27625) 69121..70490 + 1370 WP_211811641.1 IS3 family transposase -
KCG39_RS27630 (KCG39_27630) 70708..71058 + 351 WP_012540252.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
KCG39_RS27635 (KCG39_27635) 71106..71468 + 363 WP_012540111.1 arsenite efflux transporter metallochaperone ArsD -
KCG39_RS27640 (KCG39_27640) 71486..73237 + 1752 WP_012540169.1 arsenite efflux transporter ATPase subunit ArsA -
KCG39_RS27645 (KCG39_27645) 73285..74574 + 1290 WP_012540054.1 arsenite efflux transporter membrane subunit ArsB -
KCG39_RS27650 (KCG39_27650) 74587..75012 + 426 WP_012540118.1 glutaredoxin-dependent arsenate reductase -
KCG39_RS27655 (KCG39_27655) 75047..75583 - 537 WP_012540238.1 GNAT family N-acetyltransferase -
KCG39_RS27660 (KCG39_27660) 75708..77465 - 1758 WP_049010932.1 arsenical pump-driving ATPase -
KCG39_RS27665 (KCG39_27665) 77486..77848 - 363 WP_012540155.1 arsenic metallochaperone ArsD family protein -
KCG39_RS27670 (KCG39_27670) 77924..78469 - 546 WP_012540227.1 sigma-70 family RNA polymerase sigma factor -
KCG39_RS27675 (KCG39_27675) 78478..79191 - 714 WP_012540184.1 arsenical resistance protein ArsH -
KCG39_RS27680 (KCG39_27680) 79193..79516 - 324 WP_012540250.1 metalloregulator ArsR/SmtB family transcription factor -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..80069 80069
- inside IScluster/Tn - - 21432..27884 6452


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(27-152)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 162 a.a.        Molecular weight: 17810.62 Da        Isoelectric Point: 9.8560

>T199604 WP_013087172.1 NZ_CP073237:1-486 [Klebsiella pasteurii]
VGRVTVPEPLSSFHQVAEFVCGETVLDDWLKQKGLKNQALGSARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQQRTLFLKLP
Q

Download         Length: 486 bp

>T199604 NZ_CP097419:c5256135-5256033 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT

Antitoxin


Download         Length: -26600.666666667 a.a.        Molecular weight: Da        Isoelectric Point:

>AT199604 WP_012540086.1 NZ_CP073237:79816-13 [Klebsiella pasteurii]

Download         Length: -79802 bp

>AT199604 NZ_CP097419:5256027-5256171 [Klebsiella pneumoniae]
ACATATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGT
TGGCATTAATGCAGGCTAAGTCGCCTTGCACTATAAGAATAGTTTAACGCGTCAGCTTTTCCAGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5E1AVR5

Antitoxin

Source ID Structure
AlphaFold DB A0A5E1AWX8

References