Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/ElaA-DUF1778 |
| Location | 1..79816 | Replicon | plasmid pkle02 |
| Accession | NZ_CP073237 | ||
| Organism | Klebsiella pasteurii strain Sb-24 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A5E1AVR5 |
| Locus tag | KCG39_RS27240 | Protein ID | WP_013087172.1 |
| Coordinates | 1..486 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A5E1AWX8 |
| Locus tag | KCG39_RS27235 | Protein ID | WP_012540086.1 |
| Coordinates | 79816..13 (+) | Length | -26600.666666667 a.a. |
Genomic Context
Location: 1..486 (486 bp)
Type: Toxin
Protein ID: WP_013087172.1
Type: Toxin
Protein ID: WP_013087172.1
Location: 769..921 (153 bp)
Type: Others
Protein ID: Protein_2
Type: Others
Protein ID: Protein_2
Location: 866..988 (123 bp)
Type: Others
Protein ID: WP_085842394.1
Type: Others
Protein ID: WP_085842394.1
Location: 1366..1635 (270 bp)
Type: Others
Protein ID: WP_038807148.1
Type: Others
Protein ID: WP_038807148.1
Location: 1632..1982 (351 bp)
Type: Others
Protein ID: WP_063106385.1
Type: Others
Protein ID: WP_063106385.1
Location: 1997..2314 (318 bp)
Type: Others
Protein ID: WP_038807150.1
Type: Others
Protein ID: WP_038807150.1
Location: 2953..3198 (246 bp)
Type: Others
Protein ID: WP_074155869.1
Type: Others
Protein ID: WP_074155869.1
Location: 3185..3403 (219 bp)
Type: Others
Protein ID: Protein_8
Type: Others
Protein ID: Protein_8
Location: 3406..3828 (423 bp)
Type: Others
Protein ID: Protein_9
Type: Others
Protein ID: Protein_9
Location: 3984..4577 (594 bp)
Type: Others
Protein ID: WP_049141667.1
Type: Others
Protein ID: WP_049141667.1
Location: 5254..5898 (645 bp)
Type: Others
Protein ID: WP_211811642.1
Type: Others
Protein ID: WP_211811642.1
Location: 5954..6604 (651 bp)
Type: Others
Protein ID: WP_211811643.1
Type: Others
Protein ID: WP_211811643.1
Location: 6601..6909 (309 bp)
Type: Others
Protein ID: WP_211811644.1
Type: Others
Protein ID: WP_211811644.1
Location: 7009..7560 (552 bp)
Type: Others
Protein ID: WP_266098453.1
Type: Others
Protein ID: WP_266098453.1
Location: 7693..7953 (261 bp)
Type: Others
Protein ID: WP_075211167.1
Type: Others
Protein ID: WP_075211167.1
Location: 8179..8256 (78 bp)
Type: Others
Protein ID: WP_071846032.1
Type: Others
Protein ID: WP_071846032.1
Location: 8249..9274 (1026 bp)
Type: Others
Protein ID: WP_211811645.1
Type: Others
Protein ID: WP_211811645.1
Location: 10337..11488 (1152 bp)
Type: Others
Protein ID: WP_075912867.1
Type: Others
Protein ID: WP_075912867.1
Location: 11492..13627 (2136 bp)
Type: Others
Protein ID: WP_211811646.1
Type: Others
Protein ID: WP_211811646.1
Location: 13624..13890 (267 bp)
Type: Others
Protein ID: WP_211811647.1
Type: Others
Protein ID: WP_211811647.1
Location: 14270..14761 (492 bp)
Type: Others
Protein ID: Protein_21
Type: Others
Protein ID: Protein_21
Location: 14997..16217 (1221 bp)
Type: Others
Protein ID: WP_211811648.1
Type: Others
Protein ID: WP_211811648.1
Location: 16514..17065 (552 bp)
Type: Others
Protein ID: WP_211811649.1
Type: Others
Protein ID: WP_211811649.1
Location: 17363..17827 (465 bp)
Type: Others
Protein ID: WP_211811650.1
Type: Others
Protein ID: WP_211811650.1
Location: 17799..18218 (420 bp)
Type: Others
Protein ID: WP_211811651.1
Type: Others
Protein ID: WP_211811651.1
Location: 21046..21363 (318 bp)
Type: Others
Protein ID: Protein_32
Type: Others
Protein ID: Protein_32
Location: 25250..25339 (90 bp)
Type: Others
Protein ID: Protein_37
Type: Others
Protein ID: Protein_37
Location: 26041..26523 (483 bp)
Type: Others
Protein ID: Protein_39
Type: Others
Protein ID: Protein_39
Location: 26968..28078 (1111 bp)
Type: Others
Protein ID: Protein_40
Type: Others
Protein ID: Protein_40
Location: 40812..41780 (969 bp)
Type: Others
Protein ID: WP_211811630.1
Type: Others
Protein ID: WP_211811630.1
Location: 43960..44523 (564 bp)
Type: Others
Protein ID: WP_211811633.1
Type: Others
Protein ID: WP_211811633.1
Location: 47936..48676 (741 bp)
Type: Others
Protein ID: WP_001515717.1
Type: Others
Protein ID: WP_001515717.1
Location: 51211..52377 (1167 bp)
Type: Others
Protein ID: WP_000523815.1
Type: Others
Protein ID: WP_000523815.1
Location: 52377..53342 (966 bp)
Type: Others
Protein ID: WP_032740676.1
Type: Others
Protein ID: WP_032740676.1
Location: 58264..58494 (231 bp)
Type: Others
Protein ID: WP_032740680.1
Type: Others
Protein ID: WP_032740680.1
Location: 59592..61163 (1572 bp)
Type: Others
Protein ID: WP_049010905.1
Type: Others
Protein ID: WP_049010905.1
Location: 61179..61343 (165 bp)
Type: Others
Protein ID: Protein_71
Type: Others
Protein ID: Protein_71
Location: 61792..62220 (429 bp)
Type: Others
Protein ID: WP_211811638.1
Type: Others
Protein ID: WP_211811638.1
Location: 62265..62771 (507 bp)
Type: Others
Protein ID: WP_046622857.1
Type: Others
Protein ID: WP_046622857.1
Location: 62814..63005 (192 bp)
Type: Others
Protein ID: WP_049010907.1
Type: Others
Protein ID: WP_049010907.1
Location: 63206..63460 (255 bp)
Type: Others
Protein ID: WP_165454128.1
Type: Others
Protein ID: WP_165454128.1
Location: 63495..63815 (321 bp)
Type: Others
Protein ID: WP_049010910.1
Type: Others
Protein ID: WP_049010910.1
Location: 64266..64469 (204 bp)
Type: Others
Protein ID: WP_071592596.1
Type: Others
Protein ID: WP_071592596.1
Location: 64500..65042 (543 bp)
Type: Others
Protein ID: WP_064402442.1
Type: Others
Protein ID: WP_064402442.1
Location: 65091..65339 (249 bp)
Type: Others
Protein ID: WP_211811639.1
Type: Others
Protein ID: WP_211811639.1
Location: 65408..67408 (2001 bp)
Type: Others
Protein ID: WP_211811640.1
Type: Others
Protein ID: WP_211811640.1
Location: 67453..67884 (432 bp)
Type: Others
Protein ID: WP_130940021.1
Type: Others
Protein ID: WP_130940021.1
Location: 67881..68609 (729 bp)
Type: Others
Protein ID: WP_040107916.1
Type: Others
Protein ID: WP_040107916.1
Location: 68606..68932 (327 bp)
Type: Others
Protein ID: WP_038992719.1
Type: Others
Protein ID: WP_038992719.1
Location: 69121..70490 (1370 bp)
Type: Others
Protein ID: WP_211811641.1
Type: Others
Protein ID: WP_211811641.1
Location: 70708..71058 (351 bp)
Type: Others
Protein ID: WP_012540252.1
Type: Others
Protein ID: WP_012540252.1
Location: 71106..71468 (363 bp)
Type: Others
Protein ID: WP_012540111.1
Type: Others
Protein ID: WP_012540111.1
Location: 71486..73237 (1752 bp)
Type: Others
Protein ID: WP_012540169.1
Type: Others
Protein ID: WP_012540169.1
Location: 73285..74574 (1290 bp)
Type: Others
Protein ID: WP_012540054.1
Type: Others
Protein ID: WP_012540054.1
Location: 74587..75012 (426 bp)
Type: Others
Protein ID: WP_012540118.1
Type: Others
Protein ID: WP_012540118.1
Location: 18280..18525 (246 bp)
Type: Others
Protein ID: WP_211811652.1
Type: Others
Protein ID: WP_211811652.1
Location: 18537..18782 (246 bp)
Type: Others
Protein ID: WP_211811653.1
Type: Others
Protein ID: WP_211811653.1
Location: 18803..18997 (195 bp)
Type: Others
Protein ID: WP_211811654.1
Type: Others
Protein ID: WP_211811654.1
Location: 19077..19787 (711 bp)
Type: Others
Protein ID: WP_211811655.1
Type: Others
Protein ID: WP_211811655.1
Location: 19887..20361 (475 bp)
Type: Others
Protein ID: Protein_30
Type: Others
Protein ID: Protein_30
Location: 20476..20823 (348 bp)
Type: Others
Protein ID: WP_142884384.1
Type: Others
Protein ID: WP_142884384.1
Location: 23023..23886 (864 bp)
Type: Others
Protein ID: WP_211811656.1
Type: Others
Protein ID: WP_211811656.1
Location: 23970..24497 (528 bp)
Type: Others
Protein ID: WP_211811657.1
Type: Others
Protein ID: WP_211811657.1
Location: 24505..24774 (270 bp)
Type: Others
Protein ID: WP_048264996.1
Type: Others
Protein ID: WP_048264996.1
Location: 25349..25777 (429 bp)
Type: Others
Protein ID: Protein_38
Type: Others
Protein ID: Protein_38
Location: 28268..29284 (1017 bp)
Type: Others
Protein ID: WP_211811658.1
Type: Others
Protein ID: WP_211811658.1
Location: 29911..30444 (534 bp)
Type: Others
Protein ID: WP_211811659.1
Type: Others
Protein ID: WP_211811659.1
Location: 30461..30979 (519 bp)
Type: Others
Protein ID: WP_211811660.1
Type: Others
Protein ID: WP_211811660.1
Location: 30976..31494 (519 bp)
Type: Others
Protein ID: WP_228299446.1
Type: Others
Protein ID: WP_228299446.1
Location: 31503..32099 (597 bp)
Type: Others
Protein ID: WP_228299447.1
Type: Others
Protein ID: WP_228299447.1
Location: 32147..32875 (729 bp)
Type: Others
Protein ID: WP_211811666.1
Type: Others
Protein ID: WP_211811666.1
Location: 33031..35547 (2517 bp)
Type: Others
Protein ID: WP_211811667.1
Type: Others
Protein ID: WP_211811667.1
Location: 35902..36066 (165 bp)
Type: Others
Protein ID: WP_211811662.1
Type: Others
Protein ID: WP_211811662.1
Location: 36222..36755 (534 bp)
Type: Others
Protein ID: WP_211811663.1
Type: Others
Protein ID: WP_211811663.1
Location: 37218..37676 (459 bp)
Type: Others
Protein ID: Protein_50
Type: Others
Protein ID: Protein_50
Location: 37757..39265 (1509 bp)
Type: Others
Protein ID: WP_211811668.1
Type: Others
Protein ID: WP_211811668.1
Location: 39938..40623 (686 bp)
Type: Others
Protein ID: Protein_52
Type: Others
Protein ID: Protein_52
Location: 42045..42329 (285 bp)
Type: Others
Protein ID: WP_211811631.1
Type: Others
Protein ID: WP_211811631.1
Location: 42507..43070 (564 bp)
Type: Others
Protein ID: WP_211811632.1
Type: Others
Protein ID: WP_211811632.1
Location: 44598..45092 (495 bp)
Type: Others
Protein ID: WP_211811634.1
Type: Others
Protein ID: WP_211811634.1
Location: 45076..45858 (783 bp)
Type: Others
Protein ID: WP_211811635.1
Type: Others
Protein ID: WP_211811635.1
Location: 49459..50469 (1011 bp)
Type: Others
Protein ID: WP_032740675.1
Type: Others
Protein ID: WP_032740675.1
Location: 54698..55072 (375 bp)
Type: Others
Protein ID: WP_074446765.1
Type: Others
Protein ID: WP_074446765.1
Location: 55169..56458 (1290 bp)
Type: Others
Protein ID: WP_032740678.1
Type: Others
Protein ID: WP_032740678.1
Location: 56475..56900 (426 bp)
Type: Others
Protein ID: WP_032740679.1
Type: Others
Protein ID: WP_032740679.1
Location: 56903..57805 (903 bp)
Type: Others
Protein ID: WP_040107984.1
Type: Others
Protein ID: WP_040107984.1
Location: 58885..59181 (297 bp)
Type: Others
Protein ID: WP_211811637.1
Type: Others
Protein ID: WP_211811637.1
Location: 75047..75583 (537 bp)
Type: Others
Protein ID: WP_012540238.1
Type: Others
Protein ID: WP_012540238.1
Location: 75708..77465 (1758 bp)
Type: Others
Protein ID: WP_049010932.1
Type: Others
Protein ID: WP_049010932.1
Location: 77486..77848 (363 bp)
Type: Others
Protein ID: WP_012540155.1
Type: Others
Protein ID: WP_012540155.1
Location: 77924..78469 (546 bp)
Type: Others
Protein ID: WP_012540227.1
Type: Others
Protein ID: WP_012540227.1
Location: 78478..79191 (714 bp)
Type: Others
Protein ID: WP_012540184.1
Type: Others
Protein ID: WP_012540184.1
Location: 79193..79516 (324 bp)
Type: Others
Protein ID: WP_012540250.1
Type: Others
Protein ID: WP_012540250.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KCG39_RS27240 (KCG39_27240) | 1..486 | + | 486 | WP_013087172.1 | GNAT family N-acetyltransferase | Toxin |
| KCG39_RS27845 | 769..921 | + | 153 | Protein_2 | DUF5431 family protein | - |
| KCG39_RS27245 (KCG39_27245) | 866..988 | + | 123 | WP_085842394.1 | Hok/Gef family protein | - |
| KCG39_RS27250 (KCG39_27250) | 1366..1635 | + | 270 | WP_038807148.1 | hypothetical protein | - |
| KCG39_RS27255 (KCG39_27255) | 1632..1982 | + | 351 | WP_063106385.1 | hypothetical protein | - |
| KCG39_RS27260 (KCG39_27260) | 1997..2314 | + | 318 | WP_038807150.1 | hypothetical protein | - |
| KCG39_RS27850 | 2953..3198 | + | 246 | WP_074155869.1 | hypothetical protein | - |
| KCG39_RS27265 (KCG39_27265) | 3185..3403 | + | 219 | Protein_8 | hypothetical protein | - |
| KCG39_RS27270 (KCG39_27270) | 3406..3828 | + | 423 | Protein_9 | TraX family protein | - |
| KCG39_RS27275 (KCG39_27275) | 3984..4577 | + | 594 | WP_049141667.1 | fertility inhibition protein FinO | - |
| KCG39_RS27280 (KCG39_27280) | 5254..5898 | + | 645 | WP_211811642.1 | hypothetical protein | - |
| KCG39_RS27285 (KCG39_27285) | 5954..6604 | + | 651 | WP_211811643.1 | DUF2726 domain-containing protein | - |
| KCG39_RS27290 (KCG39_27290) | 6601..6909 | + | 309 | WP_211811644.1 | hypothetical protein | - |
| KCG39_RS27295 (KCG39_27295) | 7009..7560 | + | 552 | WP_266098453.1 | phospholipase D family protein | - |
| KCG39_RS27300 (KCG39_27300) | 7693..7953 | + | 261 | WP_075211167.1 | replication regulatory protein RepA | - |
| KCG39_RS27305 (KCG39_27305) | 8179..8256 | + | 78 | WP_071846032.1 | RepA leader peptide Tap | - |
| KCG39_RS27310 (KCG39_27310) | 8249..9274 | + | 1026 | WP_211811645.1 | plasmid replication initiator RepA | - |
| KCG39_RS27315 (KCG39_27315) | 10337..11488 | + | 1152 | WP_075912867.1 | tail fiber domain-containing protein | - |
| KCG39_RS27320 (KCG39_27320) | 11492..13627 | + | 2136 | WP_211811646.1 | S-type pyocin domain-containing protein | - |
| KCG39_RS27325 (KCG39_27325) | 13624..13890 | + | 267 | WP_211811647.1 | colicin immunity domain-containing protein | - |
| KCG39_RS27330 (KCG39_27330) | 14270..14761 | + | 492 | Protein_21 | Tn3 family transposase | - |
| KCG39_RS27335 (KCG39_27335) | 14997..16217 | + | 1221 | WP_211811648.1 | ISL3 family transposase | - |
| KCG39_RS27340 (KCG39_27340) | 16514..17065 | + | 552 | WP_211811649.1 | hypothetical protein | - |
| KCG39_RS27345 (KCG39_27345) | 17363..17827 | + | 465 | WP_211811650.1 | hypothetical protein | - |
| KCG39_RS27350 (KCG39_27350) | 17799..18218 | + | 420 | WP_211811651.1 | hypothetical protein | - |
| KCG39_RS27355 (KCG39_27355) | 18280..18525 | - | 246 | WP_211811652.1 | GrxA family glutaredoxin | - |
| KCG39_RS27360 (KCG39_27360) | 18537..18782 | - | 246 | WP_211811653.1 | hypothetical protein | - |
| KCG39_RS27365 (KCG39_27365) | 18803..18997 | - | 195 | WP_211811654.1 | hypothetical protein | - |
| KCG39_RS27370 (KCG39_27370) | 19077..19787 | - | 711 | WP_211811655.1 | hypothetical protein | - |
| KCG39_RS27375 (KCG39_27375) | 19887..20361 | - | 475 | Protein_30 | transposase | - |
| KCG39_RS27380 (KCG39_27380) | 20476..20823 | - | 348 | WP_142884384.1 | hypothetical protein | - |
| KCG39_RS27385 (KCG39_27385) | 21046..21363 | + | 318 | Protein_32 | AraC family transcriptional regulator | - |
| KCG39_RS27395 (KCG39_27395) | 23023..23886 | - | 864 | WP_211811656.1 | hypothetical protein | - |
| KCG39_RS27400 (KCG39_27400) | 23970..24497 | - | 528 | WP_211811657.1 | GNAT family N-acetyltransferase | - |
| KCG39_RS27405 (KCG39_27405) | 24505..24774 | - | 270 | WP_048264996.1 | DUF1778 domain-containing protein | - |
| KCG39_RS27860 | 25250..25339 | + | 90 | Protein_37 | transposase | - |
| KCG39_RS27410 (KCG39_27410) | 25349..25777 | - | 429 | Protein_38 | transposase | - |
| KCG39_RS27415 (KCG39_27415) | 26041..26523 | + | 483 | Protein_39 | integrase core domain-containing protein | - |
| KCG39_RS27420 (KCG39_27420) | 26968..28078 | + | 1111 | Protein_40 | IS3 family transposase | - |
| KCG39_RS27425 (KCG39_27425) | 28268..29284 | - | 1017 | WP_211811658.1 | hypothetical protein | - |
| KCG39_RS27430 (KCG39_27430) | 29911..30444 | - | 534 | WP_211811659.1 | fimbrial protein | - |
| KCG39_RS27435 (KCG39_27435) | 30461..30979 | - | 519 | WP_211811660.1 | fimbrial protein | - |
| KCG39_RS27440 (KCG39_27440) | 30976..31494 | - | 519 | WP_228299446.1 | fimbrial protein | - |
| KCG39_RS27445 (KCG39_27445) | 31503..32099 | - | 597 | WP_228299447.1 | fimbrial protein | - |
| KCG39_RS27450 (KCG39_27450) | 32147..32875 | - | 729 | WP_211811666.1 | fimbria/pilus periplasmic chaperone | - |
| KCG39_RS27455 (KCG39_27455) | 33031..35547 | - | 2517 | WP_211811667.1 | outer membrane usher protein | - |
| KCG39_RS27460 (KCG39_27460) | 35902..36066 | - | 165 | WP_211811662.1 | hypothetical protein | - |
| KCG39_RS27465 (KCG39_27465) | 36222..36755 | - | 534 | WP_211811663.1 | fimbrial protein | - |
| KCG39_RS27470 (KCG39_27470) | 37218..37676 | - | 459 | Protein_50 | IS3 family transposase | - |
| KCG39_RS27475 (KCG39_27475) | 37757..39265 | - | 1509 | WP_211811668.1 | group II intron reverse transcriptase/maturase | - |
| KCG39_RS27480 (KCG39_27480) | 39938..40623 | - | 686 | Protein_52 | IS3 family transposase | - |
| KCG39_RS27485 (KCG39_27485) | 40812..41780 | + | 969 | WP_211811630.1 | IS110 family transposase | - |
| KCG39_RS27490 (KCG39_27490) | 42045..42329 | - | 285 | WP_211811631.1 | hypothetical protein | - |
| KCG39_RS27495 (KCG39_27495) | 42507..43070 | - | 564 | WP_211811632.1 | helix-turn-helix transcriptional regulator | - |
| KCG39_RS27500 (KCG39_27500) | 43960..44523 | + | 564 | WP_211811633.1 | helix-turn-helix transcriptional regulator | - |
| KCG39_RS27505 (KCG39_27505) | 44598..45092 | - | 495 | WP_211811634.1 | hypothetical protein | - |
| KCG39_RS27510 (KCG39_27510) | 45076..45858 | - | 783 | WP_211811635.1 | helix-turn-helix domain-containing protein | - |
| KCG39_RS27520 (KCG39_27520) | 47936..48676 | + | 741 | WP_001515717.1 | tyrosine-type recombinase/integrase | - |
| KCG39_RS27525 (KCG39_27525) | 49459..50469 | - | 1011 | WP_032740675.1 | RepB family plasmid replication initiator protein | - |
| KCG39_RS27530 (KCG39_27530) | 51211..52377 | + | 1167 | WP_000523815.1 | plasmid-partitioning protein SopA | - |
| KCG39_RS27535 (KCG39_27535) | 52377..53342 | + | 966 | WP_032740676.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
| KCG39_RS27540 (KCG39_27540) | 54698..55072 | - | 375 | WP_074446765.1 | fluoride efflux transporter CrcB | - |
| KCG39_RS27545 (KCG39_27545) | 55169..56458 | - | 1290 | WP_032740678.1 | phosphopyruvate hydratase | - |
| KCG39_RS27550 (KCG39_27550) | 56475..56900 | - | 426 | WP_032740679.1 | universal stress protein | - |
| KCG39_RS27555 (KCG39_27555) | 56903..57805 | - | 903 | WP_040107984.1 | DHH family phosphoesterase | - |
| KCG39_RS27865 | 58264..58494 | + | 231 | WP_032740680.1 | hypothetical protein | - |
| KCG39_RS27560 (KCG39_27560) | 58885..59181 | - | 297 | WP_211811637.1 | hypothetical protein | - |
| KCG39_RS27565 (KCG39_27565) | 59592..61163 | + | 1572 | WP_049010905.1 | sensor domain-containing diguanylate cyclase | - |
| KCG39_RS27870 | 61179..61343 | + | 165 | Protein_71 | hypothetical protein | - |
| KCG39_RS27570 (KCG39_27570) | 61792..62220 | + | 429 | WP_211811638.1 | antirestriction protein | - |
| KCG39_RS27575 (KCG39_27575) | 62265..62771 | + | 507 | WP_046622857.1 | antirestriction protein ArdA | - |
| KCG39_RS27580 (KCG39_27580) | 62814..63005 | + | 192 | WP_049010907.1 | hypothetical protein | - |
| KCG39_RS27585 (KCG39_27585) | 63206..63460 | + | 255 | WP_165454128.1 | DNA polymerase III subunit theta | - |
| KCG39_RS27590 (KCG39_27590) | 63495..63815 | + | 321 | WP_049010910.1 | hypothetical protein | - |
| KCG39_RS27875 | 64266..64469 | + | 204 | WP_071592596.1 | hypothetical protein | - |
| KCG39_RS27595 (KCG39_27595) | 64500..65042 | + | 543 | WP_064402442.1 | single-stranded DNA-binding protein | - |
| KCG39_RS27600 (KCG39_27600) | 65091..65339 | + | 249 | WP_211811639.1 | DUF905 domain-containing protein | - |
| KCG39_RS27605 (KCG39_27605) | 65408..67408 | + | 2001 | WP_211811640.1 | ParB/RepB/Spo0J family partition protein | - |
| KCG39_RS27610 (KCG39_27610) | 67453..67884 | + | 432 | WP_130940021.1 | conjugation system SOS inhibitor PsiB | - |
| KCG39_RS27615 (KCG39_27615) | 67881..68609 | + | 729 | WP_040107916.1 | plasmid SOS inhibition protein A | - |
| KCG39_RS27620 (KCG39_27620) | 68606..68932 | + | 327 | WP_038992719.1 | hypothetical protein | - |
| KCG39_RS27625 (KCG39_27625) | 69121..70490 | + | 1370 | WP_211811641.1 | IS3 family transposase | - |
| KCG39_RS27630 (KCG39_27630) | 70708..71058 | + | 351 | WP_012540252.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| KCG39_RS27635 (KCG39_27635) | 71106..71468 | + | 363 | WP_012540111.1 | arsenite efflux transporter metallochaperone ArsD | - |
| KCG39_RS27640 (KCG39_27640) | 71486..73237 | + | 1752 | WP_012540169.1 | arsenite efflux transporter ATPase subunit ArsA | - |
| KCG39_RS27645 (KCG39_27645) | 73285..74574 | + | 1290 | WP_012540054.1 | arsenite efflux transporter membrane subunit ArsB | - |
| KCG39_RS27650 (KCG39_27650) | 74587..75012 | + | 426 | WP_012540118.1 | glutaredoxin-dependent arsenate reductase | - |
| KCG39_RS27655 (KCG39_27655) | 75047..75583 | - | 537 | WP_012540238.1 | GNAT family N-acetyltransferase | - |
| KCG39_RS27660 (KCG39_27660) | 75708..77465 | - | 1758 | WP_049010932.1 | arsenical pump-driving ATPase | - |
| KCG39_RS27665 (KCG39_27665) | 77486..77848 | - | 363 | WP_012540155.1 | arsenic metallochaperone ArsD family protein | - |
| KCG39_RS27670 (KCG39_27670) | 77924..78469 | - | 546 | WP_012540227.1 | sigma-70 family RNA polymerase sigma factor | - |
| KCG39_RS27675 (KCG39_27675) | 78478..79191 | - | 714 | WP_012540184.1 | arsenical resistance protein ArsH | - |
| KCG39_RS27680 (KCG39_27680) | 79193..79516 | - | 324 | WP_012540250.1 | metalloregulator ArsR/SmtB family transcription factor | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..80069 | 80069 | |
| - | inside | IScluster/Tn | - | - | 21432..27884 | 6452 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17810.62 Da Isoelectric Point: 9.8560
>T199604 WP_013087172.1 NZ_CP073237:1-486 [Klebsiella pasteurii]
VGRVTVPEPLSSFHQVAEFVCGETVLDDWLKQKGLKNQALGSARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQQRTLFLKLP
Q
VGRVTVPEPLSSFHQVAEFVCGETVLDDWLKQKGLKNQALGSARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQQRTLFLKLP
Q
Download Length: 486 bp
>T199604 NZ_CP097419:c5256135-5256033 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: -26600.666666667 a.a. Molecular weight: Da Isoelectric Point:
>AT199604 WP_012540086.1 NZ_CP073237:79816-13 [Klebsiella pasteurii]
Download Length: -79802 bp
>AT199604 NZ_CP097419:5256027-5256171 [Klebsiella pneumoniae]
ACATATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGT
TGGCATTAATGCAGGCTAAGTCGCCTTGCACTATAAGAATAGTTTAACGCGTCAGCTTTTCCAGT
ACATATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGT
TGGCATTAATGCAGGCTAAGTCGCCTTGCACTATAAGAATAGTTTAACGCGTCAGCTTTTCCAGT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5E1AVR5 |
Antitoxin
Loading, please wait
Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5E1AWX8 |