Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | pasABC/RelE-HTH |
Location | 3059523..3060000 | Replicon | chromosome |
Accession | NZ_CP072865 | ||
Organism | Rhizobium sp. NLR16a |
Toxin (Protein)
Gene name | pasB | Uniprot ID | - |
Locus tag | J7U39_RS14935 | Protein ID | WP_210628889.1 |
Coordinates | 3059523..3059792 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | pasA | Uniprot ID | - |
Locus tag | J7U39_RS14940 | Protein ID | WP_210631686.1 |
Coordinates | 3059776..3060000 (-) | Length | 75 a.a. |
Genomic Context
Location: 3060824..3061927 (1104 bp)
Type: Others
Protein ID: WP_210628891.1
Type: Others
Protein ID: WP_210628891.1
Location: 3061930..3062544 (615 bp)
Type: Others
Protein ID: WP_210628892.1
Type: Others
Protein ID: WP_210628892.1
Location: 3062550..3062915 (366 bp)
Type: Others
Protein ID: WP_210628893.1
Type: Others
Protein ID: WP_210628893.1
Location: 3055032..3058493 (3462 bp)
Type: Others
Protein ID: WP_210628887.1
Type: Others
Protein ID: WP_210628887.1
Location: 3058596..3059372 (777 bp)
Type: Others
Protein ID: WP_210628888.1
Type: Others
Protein ID: WP_210628888.1
Location: 3059523..3059792 (270 bp)
Type: Toxin
Protein ID: WP_210628889.1
Type: Toxin
Protein ID: WP_210628889.1
Location: 3059776..3060000 (225 bp)
Type: Antitoxin
Protein ID: WP_210631686.1
Type: Antitoxin
Protein ID: WP_210631686.1
Location: 3060230..3060727 (498 bp)
Type: Others
Protein ID: WP_210628890.1
Type: Others
Protein ID: WP_210628890.1
Location: 3063095..3064225 (1131 bp)
Type: Others
Protein ID: WP_210628894.1
Type: Others
Protein ID: WP_210628894.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
J7U39_RS14925 (J7U39_14925) | 3055032..3058493 | - | 3462 | WP_210628887.1 | chromosome segregation SMC family protein | - |
J7U39_RS14930 (J7U39_14930) | 3058596..3059372 | - | 777 | WP_210628888.1 | DsbA family protein | - |
J7U39_RS14935 (J7U39_14935) | 3059523..3059792 | - | 270 | WP_210628889.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
J7U39_RS14940 (J7U39_14940) | 3059776..3060000 | - | 225 | WP_210631686.1 | DUF6290 family protein | Antitoxin |
J7U39_RS14945 (J7U39_14945) | 3060230..3060727 | - | 498 | WP_210628890.1 | DUF721 domain-containing protein | - |
J7U39_RS14950 (J7U39_14950) | 3060824..3061927 | + | 1104 | WP_210628891.1 | A/G-specific adenine glycosylase | - |
J7U39_RS14955 (J7U39_14955) | 3061930..3062544 | + | 615 | WP_210628892.1 | HAD family phosphatase | - |
J7U39_RS14960 (J7U39_14960) | 3062550..3062915 | + | 366 | WP_210628893.1 | nuclear transport factor 2 family protein | - |
J7U39_RS14965 (J7U39_14965) | 3063095..3064225 | - | 1131 | WP_210628894.1 | site-specific DNA-methyltransferase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10459.98 Da Isoelectric Point: 10.0275
>T199057 WP_210628889.1 NZ_CP072865:c3059792-3059523 [Rhizobium sp. NLR16a]
MAWRIEFDRAAERELEKLGHEAARRILRFLNDRVAKLDDPRSIGEALKGSELGDFWKYRIGDYRVIASIDDGTVRILIVR
IGNRRDVYR
MAWRIEFDRAAERELEKLGHEAARRILRFLNDRVAKLDDPRSIGEALKGSELGDFWKYRIGDYRVIASIDDGTVRILIVR
IGNRRDVYR
Download Length: 270 bp
>T199057 NZ_CP097170:279279-279386 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 75 a.a. Molecular weight: 8587.78 Da Isoelectric Point: 4.8894
>AT199057 WP_210631686.1 NZ_CP072865:c3060000-3059776 [Rhizobium sp. NLR16a]
MLALRLPPEIEARLDELARRTGRSKSFYARQAILEHLDDLEDVYLAEKRLEELRRGESDTVPLAELMARHGLEN
MLALRLPPEIEARLDELARRTGRSKSFYARQAILEHLDDLEDVYLAEKRLEELRRGESDTVPLAELMARHGLEN
Download Length: 225 bp
>AT199057 NZ_CP097170:c279230-279167 [Escherichia coli]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATAACTGCAACGTGCGGGGGTTTT
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATAACTGCAACGTGCGGGGGTTTT