Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 1346843..1347371 Replicon chromosome
Accession NZ_CP071842
Organism Vibrio sp. SCSIO 43009

Toxin (Protein)


Gene name relE Uniprot ID K5TRR0
Locus tag J4N43_RS06350 Protein ID WP_005377002.1
Coordinates 1346843..1347133 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A347UR02
Locus tag J4N43_RS06355 Protein ID WP_005377003.1
Coordinates 1347123..1347371 (-) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
J4N43_RS06300 (J4N43_06285) 1342415..1342507 + 93 WP_199266794.1 DUF3265 domain-containing protein -
J4N43_RS06305 (J4N43_06290) 1342544..1343041 + 498 WP_158159696.1 DNA topology modulation protein -
J4N43_RS06310 1343026..1343094 + 69 Protein_1163 DUF3265 domain-containing protein -
J4N43_RS06315 (J4N43_06295) 1343176..1343589 + 414 WP_053350691.1 hypothetical protein -
J4N43_RS06320 (J4N43_06300) 1343604..1343696 + 93 WP_005448619.1 DUF3265 domain-containing protein -
J4N43_RS06325 (J4N43_06305) 1343722..1344288 + 567 WP_158159695.1 nucleotidyltransferase family protein -
J4N43_RS06330 (J4N43_06310) 1344406..1344867 + 462 WP_025796455.1 GIY-YIG nuclease family protein -
J4N43_RS06335 (J4N43_06315) 1345403..1345492 + 90 WP_077281742.1 DUF3265 domain-containing protein -
J4N43_RS06340 (J4N43_06320) 1345521..1346198 + 678 WP_053350849.1 response regulator -
J4N43_RS06345 1346695..1346824 + 130 Protein_1170 DUF3265 domain-containing protein -
J4N43_RS06350 (J4N43_06325) 1346843..1347133 - 291 WP_005377002.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
J4N43_RS06355 (J4N43_06330) 1347123..1347371 - 249 WP_005377003.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
J4N43_RS06360 (J4N43_06335) 1347446..1347514 + 69 WP_074531725.1 DUF3265 domain-containing protein -
J4N43_RS06365 (J4N43_06340) 1347564..1348130 + 567 WP_158159695.1 nucleotidyltransferase family protein -
J4N43_RS06370 (J4N43_06345) 1348241..1348867 + 627 WP_127891144.1 hypothetical protein -
J4N43_RS06375 (J4N43_06350) 1348894..1348986 + 93 WP_017821395.1 DUF3265 domain-containing protein -
J4N43_RS06380 (J4N43_06355) 1349016..1349465 + 450 WP_053350856.1 GNAT family N-acetyltransferase -
J4N43_RS06385 (J4N43_06360) 1349495..1349584 + 90 WP_079399706.1 DUF3265 domain-containing protein -
J4N43_RS06390 (J4N43_06365) 1349614..1349847 + 234 WP_005377029.1 hypothetical protein -
J4N43_RS06395 (J4N43_06370) 1350033..1350431 + 399 WP_062730552.1 SMI1/KNR4 family protein -
J4N43_RS06400 (J4N43_06375) 1350569..1350967 + 399 WP_025539256.1 DUF6232 family protein -
J4N43_RS06405 (J4N43_06380) 1350982..1351074 + 93 WP_127891146.1 DUF3265 domain-containing protein -
J4N43_RS06410 (J4N43_06385) 1351114..1351461 + 348 WP_031781294.1 hypothetical protein -
J4N43_RS06415 (J4N43_06390) 1351479..1351568 + 90 WP_071881309.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - vxsC / exsA / exsD / vscB / vscC / vscD / vscF / vscG / vscH / vscI / vscJ / vscK / vscL / vopS / vopR / vecA / vopQ / vscU / vscT / vscS / vscR / vscQ / vscO / vscN / vopN / tyeA/vcr1 / sycN/vcr2 / vscX / vscY / vcrD / vcrR / vcrG / vcrV / vcrH / vopB / vopD / VP1611 1289650..1658593 368943
- inside Integron - - 1333998..1376771 42773


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-83)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(12-75)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11261.25 Da        Isoelectric Point: 10.5932

>T197025 WP_005377002.1 NZ_CP071842:c1347133-1346843 [Vibrio sp. SCSIO 43009]
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVIIVTVLAVGK
RERSDVYRKAMKRLDD

Download         Length: 291 bp

>T197025 NZ_CP095529:c2754684-2754581 [Escherichia coli]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9079.37 Da        Isoelectric Point: 3.9610

>AT197025 WP_005377003.1 NZ_CP071842:c1347371-1347123 [Vibrio sp. SCSIO 43009]
MTTRILADVAASITELKANPMKVATSAYGEPVAVLNRNEPAFYCVPAEAYEMMMDRLEDLELLAIAKERESEESISVNID
DL

Download         Length: 249 bp

>AT197025 NZ_CP095529:2754543-2754811 [Escherichia coli]
AAAGTCAGCGAAGGGAATGCTTCTGGCTTTTAACAGATAAAAAGAGACCGAACACGATTCCTGTATTCGGTCCAGGGAAA
TGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGTTGGCATTAATGCAGGCTTAGTTGCCTTGCCCTTTAAGAATAGATGACG
ACGCCAGGTTTTCCAGTTTGCGTGCAAAATGGTCAATAAAAAGCGCGGTGGTCATCAGCTTAAATGTTAAAAACCGCCCG
TTCTGGTGAAAGAACTGAGGCGGTTTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A347UR03

Antitoxin

Source ID Structure
AlphaFold DB A0A347UR02

References