Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-VagC |
Location | 77328..77977 | Replicon | plasmid unnamed5 |
Accession | NZ_CP071829 | ||
Organism | Burkholderia anthina strain 1CH1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | J4G50_RS39305 | Protein ID | WP_027813527.1 |
Coordinates | 77328..77738 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A6P2T8K5 |
Locus tag | J4G50_RS39310 | Protein ID | WP_027813526.1 |
Coordinates | 77735..77977 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
J4G50_RS39260 | 72359..72649 | - | 291 | WP_027813562.1 | hypothetical protein | - |
J4G50_RS39265 | 72731..73402 | - | 672 | WP_034176084.1 | hypothetical protein | - |
J4G50_RS39270 | 73618..73872 | - | 255 | WP_046544062.1 | hypothetical protein | - |
J4G50_RS39275 | 73882..74112 | - | 231 | WP_027813533.1 | hypothetical protein | - |
J4G50_RS39280 | 74123..75208 | - | 1086 | WP_027813532.1 | hypothetical protein | - |
J4G50_RS39285 | 75253..75558 | - | 306 | WP_027813531.1 | hypothetical protein | - |
J4G50_RS39290 | 75579..76232 | - | 654 | WP_027813530.1 | helix-turn-helix domain-containing protein | - |
J4G50_RS39295 | 76420..76620 | - | 201 | WP_034176085.1 | hypothetical protein | - |
J4G50_RS39300 | 76669..77016 | - | 348 | WP_027813528.1 | hypothetical protein | - |
J4G50_RS39305 | 77328..77738 | - | 411 | WP_027813527.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
J4G50_RS39310 | 77735..77977 | - | 243 | WP_027813526.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
J4G50_RS39315 | 78072..79121 | - | 1050 | WP_027813525.1 | non-homologous end-joining DNA ligase | - |
J4G50_RS39320 | 79524..80195 | + | 672 | WP_027813524.1 | AAA family ATPase | - |
J4G50_RS39325 | 80195..81160 | + | 966 | WP_027813523.1 | ParB/RepB/Spo0J family partition protein | - |
J4G50_RS39330 | 81903..82760 | + | 858 | WP_027813522.1 | replication initiator protein A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..152479 | 152479 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14869.13 Da Isoelectric Point: 4.8604
>T197020 WP_027813527.1 NZ_CP071829:c77738-77328 [Burkholderia anthina]
MTLYLLDTNILSNVIRDPRGACATRIGETPPEQVCTSIIVAAELRFGVWKRGSSTLAQRVEQLLASLTVLPLQPDADRCY
GRLRAELEKQGQLIDANDMLIAAHALAVDAVLVTDNTAEFTRIAGLPVENWLRPAT
MTLYLLDTNILSNVIRDPRGACATRIGETPPEQVCTSIIVAAELRFGVWKRGSSTLAQRVEQLLASLTVLPLQPDADRCY
GRLRAELEKQGQLIDANDMLIAAHALAVDAVLVTDNTAEFTRIAGLPVENWLRPAT
Download Length: 411 bp
>T197020 NZ_CP095529:c2114741-2114634 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 81 a.a. Molecular weight: 9375.64 Da Isoelectric Point: 4.6856
>AT197020 WP_027813526.1 NZ_CP071829:c77977-77735 [Burkholderia anthina]
MPNHDTRHARLFRNGRSQAVRIPREFELPVSEVTIHREGRRLIIEPVEAAPLRELFAQWTPLDEIFPDIEDLPPEPVDIE
MPNHDTRHARLFRNGRSQAVRIPREFELPVSEVTIHREGRRLIIEPVEAAPLRELFAQWTPLDEIFPDIEDLPPEPVDIE
Download Length: 243 bp
>AT197020 NZ_CP095529:2114794-2114855 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGGTTTCT
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGGTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|