Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 2334914..2335559 | Replicon | chromosome |
| Accession | NZ_CP071798 | ||
| Organism | Sporosarcina sp. Te-1 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | J3U78_RS11990 | Protein ID | WP_207958896.1 |
| Coordinates | 2334914..2335264 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | J3U78_RS11995 | Protein ID | WP_243458026.1 |
| Coordinates | 2335269..2335559 (-) | Length | 97 a.a. |
Genomic Context
Location: 2338498..2339088 (591 bp)
Type: Others
Protein ID: WP_207958900.1
Type: Others
Protein ID: WP_207958900.1
Location: 2339130..2339276 (147 bp)
Type: Others
Protein ID: WP_207958901.1
Type: Others
Protein ID: WP_207958901.1
Location: 2330143..2330928 (786 bp)
Type: Others
Protein ID: WP_184212239.1
Type: Others
Protein ID: WP_184212239.1
Location: 2330903..2331373 (471 bp)
Type: Others
Protein ID: WP_207958890.1
Type: Others
Protein ID: WP_207958890.1
Location: 2331360..2331701 (342 bp)
Type: Others
Protein ID: WP_207958891.1
Type: Others
Protein ID: WP_207958891.1
Location: 2331773..2332786 (1014 bp)
Type: Others
Protein ID: WP_207958892.1
Type: Others
Protein ID: WP_207958892.1
Location: 2332803..2333204 (402 bp)
Type: Others
Protein ID: WP_207958893.1
Type: Others
Protein ID: WP_207958893.1
Location: 2333207..2333569 (363 bp)
Type: Others
Protein ID: WP_207958894.1
Type: Others
Protein ID: WP_207958894.1
Location: 2333566..2334396 (831 bp)
Type: Others
Protein ID: WP_207958895.1
Type: Others
Protein ID: WP_207958895.1
Location: 2334914..2335264 (351 bp)
Type: Toxin
Protein ID: WP_207958896.1
Type: Toxin
Protein ID: WP_207958896.1
Location: 2335269..2335559 (291 bp)
Type: Antitoxin
Protein ID: WP_243458026.1
Type: Antitoxin
Protein ID: WP_243458026.1
Location: 2335720..2336832 (1113 bp)
Type: Others
Protein ID: WP_207958897.1
Type: Others
Protein ID: WP_207958897.1
Location: 2336934..2337944 (1011 bp)
Type: Others
Protein ID: WP_207958898.1
Type: Others
Protein ID: WP_207958898.1
Location: 2338076..2338429 (354 bp)
Type: Others
Protein ID: WP_207958899.1
Type: Others
Protein ID: WP_207958899.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| J3U78_RS11955 (J3U78_11955) | 2330143..2330928 | - | 786 | WP_184212239.1 | RNA polymerase sigma factor SigB | - |
| J3U78_RS11960 (J3U78_11960) | 2330903..2331373 | - | 471 | WP_207958890.1 | anti-sigma B factor RsbW | - |
| J3U78_RS11965 (J3U78_11965) | 2331360..2331701 | - | 342 | WP_207958891.1 | anti-sigma factor antagonist | - |
| J3U78_RS11970 (J3U78_11970) | 2331773..2332786 | - | 1014 | WP_207958892.1 | PP2C family protein-serine/threonine phosphatase | - |
| J3U78_RS11975 (J3U78_11975) | 2332803..2333204 | - | 402 | WP_207958893.1 | anti-sigma regulatory factor | - |
| J3U78_RS11980 (J3U78_11980) | 2333207..2333569 | - | 363 | WP_207958894.1 | STAS domain-containing protein | - |
| J3U78_RS11985 (J3U78_11985) | 2333566..2334396 | - | 831 | WP_207958895.1 | RsbT co-antagonist protein RsbRA | - |
| J3U78_RS11990 (J3U78_11990) | 2334914..2335264 | - | 351 | WP_207958896.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| J3U78_RS11995 (J3U78_11995) | 2335269..2335559 | - | 291 | WP_243458026.1 | transcriptional regulator | Antitoxin |
| J3U78_RS12000 (J3U78_12000) | 2335720..2336832 | - | 1113 | WP_207958897.1 | alanine racemase | - |
| J3U78_RS12005 (J3U78_12005) | 2336934..2337944 | - | 1011 | WP_207958898.1 | outer-membrane lipoprotein carrier protein LolA | - |
| J3U78_RS12010 (J3U78_12010) | 2338076..2338429 | - | 354 | WP_207958899.1 | holo-ACP synthase | - |
| J3U78_RS12015 (J3U78_12015) | 2338498..2339088 | + | 591 | WP_207958900.1 | rhomboid family intramembrane serine protease | - |
| J3U78_RS12020 (J3U78_12020) | 2339130..2339276 | + | 147 | WP_207958901.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12966.90 Da Isoelectric Point: 4.9105
>T196951 WP_207958896.1 NZ_CP071798:c2335264-2334914 [Sporosarcina sp. Te-1]
MAIKRGDVFFADLSPVVGSEQGGTRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAERYGFERDSVILLEQV
RTIDKSRLTDKITHLDEQLMERVDEALEVSFGLIKF
MAIKRGDVFFADLSPVVGSEQGGTRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAERYGFERDSVILLEQV
RTIDKSRLTDKITHLDEQLMERVDEALEVSFGLIKF
Download Length: 351 bp
>T196951 NZ_CP095518:c1953206-1953099 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAGCTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAGCTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 97 a.a. Molecular weight: 11310.19 Da Isoelectric Point: 6.6438
>AT196951 WP_243458026.1 NZ_CP071798:c2335559-2335269 [Sporosarcina sp. Te-1]
VLVLREKKNIKEVIVKIPKRMLTEIEHTVVHQEPEREEFVYVSTKRYVTDYEAETIREVMMKGYVEMSHINLKIAKECLH
AELEAQHTMERLVSGG
VLVLREKKNIKEVIVKIPKRMLTEIEHTVVHQEPEREEFVYVSTKRYVTDYEAETIREVMMKGYVEMSHINLKIAKECLH
AELEAQHTMERLVSGG
Download Length: 291 bp
>AT196951 NZ_CP095518:1953263-1953320 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT