Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 4584612..4585239 | Replicon | chromosome |
| Accession | NZ_CP071182 | ||
| Organism | Alicyclobacillus ferrooxydans strain S30H14 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | JZ786_RS21700 | Protein ID | WP_206656358.1 |
| Coordinates | 4584612..4584962 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | JZ786_RS21705 | Protein ID | WP_206656359.1 |
| Coordinates | 4584967..4585239 (-) | Length | 91 a.a. |
Genomic Context
Location: 4581993..4582550 (558 bp)
Type: Others
Protein ID: WP_206656353.1
Type: Others
Protein ID: WP_206656353.1
Location: 4582854..4583468 (615 bp)
Type: Others
Protein ID: WP_206656354.1
Type: Others
Protein ID: WP_206656354.1
Location: 4583498..4583752 (255 bp)
Type: Others
Protein ID: WP_206656355.1
Type: Others
Protein ID: WP_206656355.1
Location: 4580745..4581407 (663 bp)
Type: Others
Protein ID: WP_206656351.1
Type: Others
Protein ID: WP_206656351.1
Location: 4581575..4581736 (162 bp)
Type: Others
Protein ID: WP_206656352.1
Type: Others
Protein ID: WP_206656352.1
Location: 4583864..4584082 (219 bp)
Type: Others
Protein ID: WP_206656356.1
Type: Others
Protein ID: WP_206656356.1
Location: 4584134..4584373 (240 bp)
Type: Others
Protein ID: WP_206656357.1
Type: Others
Protein ID: WP_206656357.1
Location: 4584612..4584962 (351 bp)
Type: Toxin
Protein ID: WP_206656358.1
Type: Toxin
Protein ID: WP_206656358.1
Location: 4584967..4585239 (273 bp)
Type: Antitoxin
Protein ID: WP_206656359.1
Type: Antitoxin
Protein ID: WP_206656359.1
Location: 4585351..4586553 (1203 bp)
Type: Others
Protein ID: WP_206656360.1
Type: Others
Protein ID: WP_206656360.1
Location: 4586689..4587687 (999 bp)
Type: Others
Protein ID: WP_206656361.1
Type: Others
Protein ID: WP_206656361.1
Location: 4587740..4589197 (1458 bp)
Type: Others
Protein ID: WP_206656362.1
Type: Others
Protein ID: WP_206656362.1
Location: 4589269..4589643 (375 bp)
Type: Others
Protein ID: WP_206656363.1
Type: Others
Protein ID: WP_206656363.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JZ786_RS21665 | 4580745..4581407 | - | 663 | WP_206656351.1 | DUF190 domain-containing protein | - |
| JZ786_RS21670 | 4581575..4581736 | - | 162 | WP_206656352.1 | hypothetical protein | - |
| JZ786_RS21675 | 4581993..4582550 | + | 558 | WP_206656353.1 | c-type cytochrome | - |
| JZ786_RS21680 | 4582854..4583468 | + | 615 | WP_206656354.1 | VTT domain-containing protein | - |
| JZ786_RS21685 | 4583498..4583752 | + | 255 | WP_206656355.1 | DUF1450 domain-containing protein | - |
| JZ786_RS21690 | 4583864..4584082 | - | 219 | WP_206656356.1 | DUF2922 family protein | - |
| JZ786_RS21695 | 4584134..4584373 | - | 240 | WP_206656357.1 | DUF1659 domain-containing protein | - |
| JZ786_RS21700 | 4584612..4584962 | - | 351 | WP_206656358.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| JZ786_RS21705 | 4584967..4585239 | - | 273 | WP_206656359.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| JZ786_RS21710 | 4585351..4586553 | - | 1203 | WP_206656360.1 | alanine racemase | - |
| JZ786_RS21715 | 4586689..4587687 | - | 999 | WP_206656361.1 | outer membrane lipoprotein carrier protein LolA | - |
| JZ786_RS21720 | 4587740..4589197 | - | 1458 | WP_206656362.1 | NAD(P)H-hydrate dehydratase | - |
| JZ786_RS21725 | 4589269..4589643 | - | 375 | WP_206656363.1 | holo-ACP synthase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12919.86 Da Isoelectric Point: 5.6328
>T195532 WP_206656358.1 NZ_CP071182:c4584962-4584612 [Alicyclobacillus ferrooxydans]
MNVKRGDIFFADLSPVVGSEQGGFRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEVQGREGGLERDSVILLEQI
RTIDKQRLTDKITHLDDEMMRHVNEALQISLGLVDF
MNVKRGDIFFADLSPVVGSEQGGFRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEVQGREGGLERDSVILLEQI
RTIDKQRLTDKITHLDDEMMRHVNEALQISLGLVDF
Download Length: 351 bp
>T195532 NZ_CP094755:1873243-1873338 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 91 a.a. Molecular weight: 10332.85 Da Isoelectric Point: 8.5778
>AT195532 WP_206656359.1 NZ_CP071182:c4585239-4584967 [Alicyclobacillus ferrooxydans]
VSEKKRIVLSISQQLLEQVDGIAQRRQTNRSEVIREAMRQYVVERRKDDIRIALQQGYLEMAPINLRMASEAFFVEQEAG
GTVERLVSGV
VSEKKRIVLSISQQLLEQVDGIAQRRQTNRSEVIREAMRQYVVERRKDDIRIALQQGYLEMAPINLRMASEAFFVEQEAG
GTVERLVSGV
Download Length: 273 bp
>AT195532 NZ_CP094755:c1873423-1873366 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG