Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relB-yefM/YoeB-RelB |
Location | 848563..849077 | Replicon | chromosome |
Accession | NZ_CP071094 | ||
Organism | Fusobacterium polymorphum strain THCT15E1 |
Toxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | JY397_RS04325 | Protein ID | WP_098978559.1 |
Coordinates | 848820..849077 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | JY397_RS04320 | Protein ID | WP_098978558.1 |
Coordinates | 848563..848820 (+) | Length | 86 a.a. |
Genomic Context
Location: 843695..845788 (2094 bp)
Type: Others
Protein ID: WP_220303372.1
Type: Others
Protein ID: WP_220303372.1
Location: 845828..846301 (474 bp)
Type: Others
Protein ID: WP_005894577.1
Type: Others
Protein ID: WP_005894577.1
Location: 846327..847325 (999 bp)
Type: Others
Protein ID: WP_220303373.1
Type: Others
Protein ID: WP_220303373.1
Location: 847369..848436 (1068 bp)
Type: Others
Protein ID: WP_005901428.1
Type: Others
Protein ID: WP_005901428.1
Location: 848563..848820 (258 bp)
Type: Antitoxin
Protein ID: WP_098978558.1
Type: Antitoxin
Protein ID: WP_098978558.1
Location: 848820..849077 (258 bp)
Type: Toxin
Protein ID: WP_098978559.1
Type: Toxin
Protein ID: WP_098978559.1
Location: 849194..850270 (1077 bp)
Type: Others
Protein ID: WP_023037955.1
Type: Others
Protein ID: WP_023037955.1
Location: 850502..851239 (738 bp)
Type: Others
Protein ID: WP_023037954.1
Type: Others
Protein ID: WP_023037954.1
Location: 851362..851715 (354 bp)
Type: Others
Protein ID: WP_023037953.1
Type: Others
Protein ID: WP_023037953.1
Location: 851810..852376 (567 bp)
Type: Others
Protein ID: WP_023037952.1
Type: Others
Protein ID: WP_023037952.1
Location: 852578..852910 (333 bp)
Type: Others
Protein ID: WP_023037951.1
Type: Others
Protein ID: WP_023037951.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JY397_RS04300 (JY397_04295) | 843695..845788 | + | 2094 | WP_220303372.1 | outer membrane protein assembly factor | - |
JY397_RS04305 (JY397_04300) | 845828..846301 | + | 474 | WP_005894577.1 | OmpH family outer membrane protein | - |
JY397_RS04310 (JY397_04305) | 846327..847325 | + | 999 | WP_220303373.1 | UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase | - |
JY397_RS04315 (JY397_04310) | 847369..848436 | + | 1068 | WP_005901428.1 | glycerophosphodiester phosphodiesterase | - |
JY397_RS04320 (JY397_04315) | 848563..848820 | + | 258 | WP_098978558.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
JY397_RS04325 (JY397_04320) | 848820..849077 | + | 258 | WP_098978559.1 | Txe/YoeB family addiction module toxin | Toxin |
JY397_RS04330 (JY397_04325) | 849194..850270 | + | 1077 | WP_023037955.1 | DHH family phosphoesterase | - |
JY397_RS04335 (JY397_04330) | 850502..851239 | + | 738 | WP_023037954.1 | tRNA pseudouridine(38-40) synthase TruA | - |
JY397_RS04340 (JY397_04335) | 851362..851715 | + | 354 | WP_023037953.1 | hypothetical protein | - |
JY397_RS04345 (JY397_04340) | 851810..852376 | + | 567 | WP_023037952.1 | hypothetical protein | - |
JY397_RS04350 (JY397_04345) | 852578..852910 | + | 333 | WP_023037951.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 10144.74 Da Isoelectric Point: 9.7287
>T195281 WP_098978559.1 NZ_CP071094:848820-849077 [Fusobacterium polymorphum]
MLLTWTDFAWKQYEELQEKDKRLIKKINILIKDIKRNGNEGIGKPEPLQHELSGYWSRRIDDKNRLVYKVSDSQIIIVAC
ANHYK
MLLTWTDFAWKQYEELQEKDKRLIKKINILIKDIKRNGNEGIGKPEPLQHELSGYWSRRIDDKNRLVYKVSDSQIIIVAC
ANHYK
Download Length: 258 bp
>T195281 NZ_CP094479:1915149-1915251 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 86 a.a. Molecular weight: 10122.48 Da Isoelectric Point: 4.7022
>AT195281 WP_098978558.1 NZ_CP071094:848563-848820 [Fusobacterium polymorphum]
MIATNYSEVRNNLKAYCDKATKDYEIIIITRKNNENVVLMSEEEYNNLMENLYIRSNLKYYQKLVESIKEVEKGNVKEHD
LIEVD
MIATNYSEVRNNLKAYCDKATKDYEIIIITRKNNENVVLMSEEEYNNLMENLYIRSNLKYYQKLVESIKEVEKGNVKEHD
LIEVD
Download Length: 258 bp
>AT195281 NZ_CP094479:c1915258-1915113 [Klebsiella pneumoniae]
TAAAGATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAG
TTGGCATTAATGCAGGCTAAGTCGCCTTGCACTATAAGAATAGTTTAACGCGTCAGCTTTTCCAGT
TAAAGATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAG
TTGGCATTAATGCAGGCTAAGTCGCCTTGCACTATAAGAATAGTTTAACGCGTCAGCTTTTCCAGT