Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | paaR-paaA-parE/- |
| Location | 3027739..3028210 | Replicon | chromosome |
| Accession | NZ_CP069707 | ||
| Organism | Escherichia coli strain E41 | ||
Toxin (Protein)
| Gene name | parE_1 | Uniprot ID | A0A0D7C2L1 |
| Locus tag | JSQ86_RS14885 | Protein ID | WP_001303511.1 |
| Coordinates | 3027932..3028210 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | paaA | Uniprot ID | Q8XAD5 |
| Locus tag | JSQ86_RS14880 | Protein ID | WP_001302048.1 |
| Coordinates | 3027739..3027930 (+) | Length | 64 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JSQ86_RS14830 | 3022848..3023717 | - | 870 | WP_000207991.1 | DUF551 domain-containing protein | - |
| JSQ86_RS14835 | 3023728..3023991 | - | 264 | WP_000224233.1 | hypothetical protein | - |
| JSQ86_RS14840 | 3023993..3024210 | - | 218 | Protein_2908 | DUF4014 family protein | - |
| JSQ86_RS14845 | 3024243..3024455 | - | 213 | WP_000935421.1 | hypothetical protein | - |
| JSQ86_RS14850 | 3024506..3024862 | - | 357 | WP_024249813.1 | hypothetical protein | - |
| JSQ86_RS14855 | 3024920..3025342 | - | 423 | WP_001151130.1 | DUF977 family protein | - |
| JSQ86_RS14860 | 3025383..3026453 | - | 1071 | WP_191642465.1 | phage replisome organizer | - |
| JSQ86_RS14865 | 3026525..3026950 | - | 426 | WP_001678565.1 | hypothetical protein | - |
| JSQ86_RS14870 | 3026947..3027249 | - | 303 | WP_204098011.1 | transcriptional regulator | - |
| JSQ86_RS14875 | 3027347..3027718 | + | 372 | WP_122985828.1 | hypothetical protein | - |
| JSQ86_RS14880 | 3027739..3027930 | + | 192 | WP_001302048.1 | hypothetical protein | Antitoxin |
| JSQ86_RS14885 | 3027932..3028210 | + | 279 | WP_001303511.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JSQ86_RS14890 | 3028502..3028657 | + | 156 | WP_032154077.1 | DUF1391 family protein | - |
| JSQ86_RS14895 | 3028798..3029424 | + | 627 | WP_203373727.1 | hypothetical protein | - |
| JSQ86_RS14900 | 3029425..3029634 | - | 210 | WP_033813301.1 | hypothetical protein | - |
| JSQ86_RS14905 | 3030202..3030390 | + | 189 | WP_086625363.1 | cell division inhibition protein DicB | - |
| JSQ86_RS14910 | 3030387..3030590 | + | 204 | WP_086625364.1 | DUF1482 family protein | - |
| JSQ86_RS14915 | 3030671..3033154 | + | 2484 | WP_204098012.1 | exonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | ompA | 3018740..3063937 | 45197 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10661.25 Da Isoelectric Point: 5.5647
>T191694 WP_001303511.1 NZ_CP069707:3027932-3028210 [Escherichia coli]
MLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSEHPYLYPPSDRVPGLREIVAHPNYIILYRVTTSSVE
VVNVIHARRQFP
MLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSEHPYLYPPSDRVPGLREIVAHPNYIILYRVTTSSVE
VVNVIHARRQFP
Download Length: 279 bp
>T191694 NZ_CP091884:c333036-332941 [Enterococcus faecalis]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 64 a.a. Molecular weight: 7463.47 Da Isoelectric Point: 8.6828
>AT191694 WP_001302048.1 NZ_CP069707:3027739-3027930 [Escherichia coli]
MNRALSPMVSEFETIEQENSYNEWLRAKVATSLADPRPAIPHDEVERRMAERFAKMRKERSKQ
MNRALSPMVSEFETIEQENSYNEWLRAKVATSLADPRPAIPHDEVERRMAERFAKMRKERSKQ
Download Length: 192 bp
>AT191694 NZ_CP091884:332841-332906 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|