Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 928762..929288 | Replicon | chromosome |
Accession | NZ_CP069459 | ||
Organism | Escherichia coli strain FDAARGOS_1249 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | I6J79_RS04410 | Protein ID | WP_000323025.1 |
Coordinates | 928762..929049 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | I6J79_RS04415 | Protein ID | WP_000534858.1 |
Coordinates | 929049..929288 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
I6J79_RS04370 | 923958..924170 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
I6J79_RS04375 | 924225..924314 | + | 90 | WP_120795389.1 | hypothetical protein | - |
I6J79_RS04380 | 924592..925344 | - | 753 | WP_001047135.1 | antitermination protein | - |
I6J79_RS04385 | 925358..926407 | - | 1050 | WP_001265199.1 | DUF968 domain-containing protein | - |
I6J79_RS04390 | 926409..926687 | - | 279 | WP_032351280.1 | hypothetical protein | - |
I6J79_RS04395 | 926754..927005 | - | 252 | WP_000980994.1 | hypothetical protein | - |
I6J79_RS04400 | 927222..927359 | - | 138 | WP_044703989.1 | type I toxin-antitoxin system Hok family toxin | - |
I6J79_RS04405 | 927426..928639 | + | 1214 | WP_204147805.1 | IS3 family transposase | - |
I6J79_RS04410 | 928762..929049 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
I6J79_RS04415 | 929049..929288 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
I6J79_RS04420 | 929313..929618 | + | 306 | WP_001326990.1 | hypothetical protein | - |
I6J79_RS04425 | 929821..930153 | + | 333 | WP_001301033.1 | protein FlxA | - |
I6J79_RS04430 | 930590..931903 | - | 1314 | Protein_876 | ISNCY family transposase | - |
I6J79_RS04435 | 932672..932959 | - | 288 | Protein_877 | hypothetical protein | - |
I6J79_RS04440 | 933570..933926 | - | 357 | WP_001310834.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 890903..947777 | 56874 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T190538 WP_000323025.1 NZ_CP069459:c929049-928762 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
>T190538 NZ_CP091427:c1922516-1922409 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 80 a.a. Molecular weight: 9071.48 Da Isoelectric Point: 4.5230
>AT190538 WP_000534858.1 NZ_CP069459:c929288-929049 [Escherichia coli]
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
Download Length: 240 bp
>AT190538 NZ_CP091427:1922563-1922629 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|