Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 758497..759130 | Replicon | chromosome |
Accession | NZ_CP069073 | ||
Organism | Mycobacterium tuberculosis strain N0054 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | JN140_RS03505 | Protein ID | WP_015629650.1 |
Coordinates | 758497..758880 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ56 |
Locus tag | JN140_RS03510 | Protein ID | WP_003403368.1 |
Coordinates | 758975..759130 (-) | Length | 52 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN140_RS03480 | 753789..754325 | + | 537 | WP_003403341.1 | 50S ribosomal protein L10 | - |
JN140_RS03485 | 754362..754754 | + | 393 | WP_003403353.1 | 50S ribosomal protein L7/L12 | - |
JN140_RS03490 | 754747..755442 | - | 696 | WP_003403355.1 | TetR/AcrR family transcriptional regulator | - |
JN140_RS03495 | 755513..757018 | + | 1506 | WP_003403360.1 | carotenoid cleavage oxygenase | - |
JN140_RS03500 | 757099..758109 | + | 1011 | WP_003911248.1 | ABC transporter ATP-binding protein | - |
JN140_RS03505 | 758497..758880 | - | 384 | WP_015629650.1 | hypothetical protein | Toxin |
JN140_RS03510 | 758975..759130 | - | 156 | WP_003403368.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
JN140_RS03515 | 759206..759922 | - | 717 | WP_003403371.1 | CPBP family intramembrane metalloprotease | - |
JN140_RS03520 | 760198..760506 | - | 309 | WP_003403376.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
JN140_RS03525 | 760493..760738 | - | 246 | WP_003403381.1 | ribbon-helix-helix protein, CopG family | - |
JN140_RS03530 | 760848..761285 | - | 438 | WP_003403386.1 | type II toxin-antitoxin system VapC family toxin | - |
JN140_RS03535 | 761282..761536 | - | 255 | WP_003911263.1 | antitoxin VapB7 | - |
JN140_RS03540 | 761650..764013 | + | 2364 | WP_003403397.1 | arylsulfatase AtsD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13886.68 Da Isoelectric Point: 6.0803
>T189534 WP_015629650.1 NZ_CP069073:c758880-758497 [Mycobacterium tuberculosis]
MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQMSRMFGDVYPDVPVPKSVWRLIDSAQHRLARAGAVG
ALSVVDLLICDTAAARGLVVLHDDADYELAERHLPDIRVRRVVSADD
MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQMSRMFGDVYPDVPVPKSVWRLIDSAQHRLARAGAVG
ALSVVDLLICDTAAARGLVVLHDDADYELAERHLPDIRVRRVVSADD
Download Length: 384 bp
>T189534 NZ_CP090870:300233-300328 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 52 a.a. Molecular weight: 5872.72 Da Isoelectric Point: 5.7734
>AT189534 WP_003403368.1 NZ_CP069073:c759130-758975 [Mycobacterium tuberculosis]
VSVTQIDLDDEALADVMRIAAVHTKKEAVNLAMRDYVERFRRIEALARSRE
VSVTQIDLDDEALADVMRIAAVHTKKEAVNLAMRDYVERFRRIEALARSRE
Download Length: 156 bp
>AT189534 NZ_CP090870:c300413-300356 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|