Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2138996..2139522 | Replicon | chromosome |
Accession | NZ_CP068706 | ||
Organism | Escherichia coli strain J53-p1-pV-hybrid-1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | JK375_RS10360 | Protein ID | WP_000323025.1 |
Coordinates | 2139235..2139522 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | JK375_RS10355 | Protein ID | WP_000534858.1 |
Coordinates | 2138996..2139235 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JK375_RS10300 | 2134023..2134790 | - | 768 | Protein_2012 | exonuclease | - |
JK375_RS10305 | 2134883..2135074 | - | 192 | WP_001083297.1 | lysis protein YdfD | - |
JK375_RS10310 | 2135071..2135259 | - | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
JK375_RS10315 | 2135827..2136045 | - | 219 | WP_001171942.1 | hypothetical protein | - |
JK375_RS10320 | 2136205..2136360 | - | 156 | WP_000379575.1 | DUF1391 family protein | - |
JK375_RS10325 | 2136527..2136934 | - | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
JK375_RS10330 | 2137018..2137248 | + | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
JK375_RS10335 | 2137232..2137510 | + | 279 | Protein_2019 | hypothetical protein | - |
JK375_RS10340 | 2137545..2137694 | + | 150 | WP_011443592.1 | hypothetical protein | - |
JK375_RS10345 | 2138131..2138463 | - | 333 | WP_001301033.1 | protein FlxA | - |
JK375_RS10350 | 2138666..2138971 | - | 306 | WP_001326990.1 | hypothetical protein | - |
JK375_RS10355 | 2138996..2139235 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
JK375_RS10360 | 2139235..2139522 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
JK375_RS10365 | 2139594..2139749 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
JK375_RS10370 | 2139966..2140217 | + | 252 | WP_000980994.1 | hypothetical protein | - |
JK375_RS10375 | 2140284..2140562 | + | 279 | WP_012304870.1 | hypothetical protein | - |
JK375_RS10380 | 2140564..2141613 | + | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
JK375_RS10385 | 2141627..2142379 | + | 753 | WP_001047135.1 | antitermination protein | - |
JK375_RS10390 | 2142657..2142746 | - | 90 | WP_120795389.1 | hypothetical protein | - |
JK375_RS10395 | 2142801..2143013 | - | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
JK375_RS10400 | 2143314..2143529 | + | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
JK375_RS10405 | 2144283..2144498 | + | 216 | WP_000839590.1 | phage lysis protein EssD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2127375..2160763 | 33388 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T187640 WP_000323025.1 NZ_CP068706:2139235-2139522 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
>T187640 NZ_CP089932:2185591-2185680 [Erwinia tracheiphila]
AAGCCTGCATTAATGCCAACTTTTAGCGCATGGCTCTGAACAGAGCCATTTCCCTGGACTGAAGACAGGAGTTGTCTTCA
GTCTTTTTTT
AAGCCTGCATTAATGCCAACTTTTAGCGCATGGCTCTGAACAGAGCCATTTCCCTGGACTGAAGACAGGAGTTGTCTTCA
GTCTTTTTTT
Antitoxin
Download Length: 80 a.a. Molecular weight: 9071.48 Da Isoelectric Point: 4.5230
>AT187640 WP_000534858.1 NZ_CP068706:2138996-2139235 [Escherichia coli]
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
Download Length: 240 bp
>AT187640 NZ_CP089932:c2185681-2185591 [Erwinia tracheiphila]
TAAAAAAAGACTGAAGACAACTCCTGTCTTCAGTCCAGGGAAATGGCTCTGTTCAGAGCCATGCGCTAAAAGTTGGCATT
AATGCAGGCTT
TAAAAAAAGACTGAAGACAACTCCTGTCTTCAGTCCAGGGAAATGGCTCTGTTCAGAGCCATGCGCTAAAAGTTGGCATT
AATGCAGGCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|