Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-RHH |
| Location | 162..3184644 | Replicon | chromosome |
| Accession | NZ_CP066060 | ||
| Organism | Actinomyces oris strain FDAARGOS_1051 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | I6I08_RS00010 | Protein ID | WP_141406424.1 |
| Coordinates | 162..452 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1Q8WM28 |
| Locus tag | I6I08_RS00005 | Protein ID | WP_075379422.1 |
| Coordinates | 3184644..165 (+) | Length | -1061492.6666667 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I6I08_RS00010 | 162..452 | + | 291 | WP_141406424.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| I6I08_RS00015 | 552..1523 | + | 972 | WP_141406425.1 | diaminopimelate dehydrogenase | - |
| I6I08_RS00020 | 1596..2675 | - | 1080 | WP_141406426.1 | glycosyltransferase family 2 protein | - |
| I6I08_RS00025 | 2819..3892 | + | 1074 | WP_141406427.1 | glycosyltransferase family 2 protein | - |
| I6I08_RS00030 | 3889..4941 | + | 1053 | WP_141406428.1 | glycosyltransferase | - |
| I6I08_RS00035 | 5129..6394 | - | 1266 | WP_141406429.1 | hypothetical protein | - |
| I6I08_RS00040 | 6509..7168 | - | 660 | WP_075254898.1 | chain-length determining protein | - |
| I6I08_RS00045 | 7411..8193 | - | 783 | WP_141406430.1 | TetR/AcrR family transcriptional regulator | - |
| I6I08_RS00050 | 8198..9418 | - | 1221 | WP_141406431.1 | acyltransferase | - |
| I6I08_RS00060 | 9914..10906 | + | 993 | WP_075379414.1 | NTP transferase domain-containing protein | - |
| I6I08_RS00065 | 11044..12036 | + | 993 | WP_003787536.1 | ribose-phosphate diphosphokinase | - |
| I6I08_RS00070 | 12454..14382 | + | 1929 | WP_141406432.1 | hypothetical protein | - |
| I6I08_RS00075 | 14500..16758 | - | 2259 | WP_141406433.1 | chain-length determining protein | - |
| I6I08_RS00080 | 17255..18607 | + | 1353 | WP_141406434.1 | hypothetical protein | - |
| I6I08_RS00085 | 18766..19794 | + | 1029 | WP_141406435.1 | FRG domain-containing protein | - |
| I6I08_RS00090 | 19924..23673 | + | 3750 | WP_141406436.1 | transcription-repair coupling factor | - |
| I6I08_RS00095 | 23708..24385 | - | 678 | WP_141406437.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS00100 | 24382..25473 | - | 1092 | WP_141406438.1 | hypothetical protein | - |
| I6I08_RS00105 | 25470..25925 | - | 456 | WP_170198591.1 | hypothetical protein | - |
| I6I08_RS00110 | 26905..27792 | + | 888 | WP_141406440.1 | hypothetical protein | - |
| I6I08_RS00115 | 28002..29288 | + | 1287 | WP_075375403.1 | phosphopyruvate hydratase | - |
| I6I08_RS00120 | 29524..30216 | + | 693 | WP_141406441.1 | septum formation initiator family protein | - |
| I6I08_RS00125 | 30213..30728 | + | 516 | WP_198498131.1 | DUF501 domain-containing protein | - |
| I6I08_RS00130 | 30784..31809 | + | 1026 | WP_141406442.1 | exopolyphosphatase | - |
| I6I08_RS00135 | 31806..32678 | + | 873 | WP_141406443.1 | type I 3-dehydroquinate dehydratase | - |
| I6I08_RS00140 | 32780..33277 | - | 498 | WP_141406444.1 | NTP pyrophosphohydrolase | - |
| I6I08_RS00145 | 33530..34117 | + | 588 | WP_141406445.1 | hypothetical protein | - |
| I6I08_RS00150 | 34501..35112 | + | 612 | WP_141406446.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| I6I08_RS00155 | 35212..35814 | + | 603 | WP_141406447.1 | aminoacyl-tRNA hydrolase | - |
| I6I08_RS00160 | 35825..36559 | - | 735 | WP_141406448.1 | response regulator transcription factor | - |
| I6I08_RS00165 | 36541..38106 | - | 1566 | WP_141406653.1 | histidine kinase | - |
| I6I08_RS00170 | 38475..39377 | - | 903 | WP_141406449.1 | ABC transporter permease subunit | - |
| I6I08_RS00175 | 39445..40413 | - | 969 | WP_141406450.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS00180 | 40848..41843 | + | 996 | WP_141406451.1 | Bax inhibitor-1/YccA family protein | - |
| I6I08_RS00185 | 42060..42467 | + | 408 | WP_141406452.1 | FKBP-type peptidyl-prolyl cis-trans isomerase | - |
| I6I08_RS00190 | 42836..44722 | + | 1887 | WP_010613899.1 | dihydroxy-acid dehydratase | - |
| I6I08_RS00195 | 44804..45655 | + | 852 | WP_141406453.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS00200 | 45652..46602 | + | 951 | WP_141406454.1 | ATP-binding cassette domain-containing protein | - |
| I6I08_RS00205 | 46666..48222 | + | 1557 | WP_141406455.1 | ABC transporter substrate-binding protein | - |
| I6I08_RS00210 | 48228..49964 | + | 1737 | WP_141406654.1 | ABC transporter permease subunit | - |
| I6I08_RS00215 | 50129..50662 | - | 534 | WP_010613904.1 | DUF4242 domain-containing protein | - |
| I6I08_RS00220 | 50817..51140 | - | 324 | WP_010613905.1 | helix-turn-helix domain-containing protein | - |
| I6I08_RS00225 | 51137..51490 | - | 354 | WP_141406655.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| I6I08_RS00230 | 51644..53209 | + | 1566 | WP_141406456.1 | threonine ammonia-lyase, biosynthetic | - |
| I6I08_RS00235 | 53414..53968 | + | 555 | WP_003787469.1 | NAD(P)H-dependent oxidoreductase | - |
| I6I08_RS00240 | 54114..56087 | + | 1974 | Protein_46 | ABC-ATPase domain-containing protein | - |
| I6I08_RS00245 | 56268..57218 | + | 951 | WP_141406457.1 | hypothetical protein | - |
| I6I08_RS00250 | 57348..58076 | - | 729 | WP_141406458.1 | hypothetical protein | - |
| I6I08_RS00255 | 58558..58995 | + | 438 | WP_070513944.1 | hypothetical protein | - |
| I6I08_RS00260 | 59190..60452 | + | 1263 | WP_141406459.1 | hypothetical protein | - |
| I6I08_RS00265 | 60632..61126 | + | 495 | WP_141406460.1 | hypothetical protein | - |
| I6I08_RS00270 | 61254..61970 | - | 717 | WP_141406461.1 | peptide-methionine (S)-S-oxide reductase MsrA | - |
| I6I08_RS00275 | 62138..62623 | - | 486 | WP_003787454.1 | transcription elongation factor GreA | - |
| I6I08_RS00280 | 62966..63676 | - | 711 | WP_141406462.1 | hemolysin III family protein | - |
| I6I08_RS00285 | 64042..64869 | + | 828 | WP_141406463.1 | undecaprenyl diphosphate synthase family protein | - |
| I6I08_RS00290 | 65090..65803 | - | 714 | WP_141406464.1 | FadR family transcriptional regulator | - |
| I6I08_RS00295 | 65929..66456 | + | 528 | WP_141406465.1 | gluconokinase | - |
| I6I08_RS00300 | 66597..68009 | + | 1413 | WP_141406466.1 | gluconate:H+ symporter | - |
| I6I08_RS00305 | 68348..69925 | + | 1578 | WP_141406467.1 | DEAD/DEAH box helicase | - |
| I6I08_RS00310 | 70158..71012 | + | 855 | WP_141406656.1 | hypothetical protein | - |
| I6I08_RS00320 | 71635..71793 | - | 159 | WP_170198593.1 | hypothetical protein | - |
| I6I08_RS00325 | 71790..72272 | - | 483 | WP_141406468.1 | hypothetical protein | - |
| I6I08_RS00330 | 72272..72688 | - | 417 | WP_141406657.1 | hypothetical protein | - |
| I6I08_RS00335 | 72666..74135 | - | 1470 | WP_170198594.1 | hypothetical protein | - |
| I6I08_RS00340 | 74459..75055 | - | 597 | WP_141406470.1 | hypothetical protein | - |
| I6I08_RS00345 | 75262..76032 | - | 771 | WP_141406471.1 | hypothetical protein | - |
| I6I08_RS00350 | 76029..77153 | - | 1125 | WP_141406472.1 | hypothetical protein | - |
| I6I08_RS00355 | 77157..78971 | - | 1815 | WP_141406473.1 | hypothetical protein | - |
| I6I08_RS00360 | 78971..83206 | - | 4236 | WP_141406474.1 | C40 family peptidase | - |
| I6I08_RS00365 | 83256..83630 | - | 375 | WP_141406475.1 | hypothetical protein | - |
| I6I08_RS00370 | 83681..84016 | - | 336 | WP_141406476.1 | hypothetical protein | - |
| I6I08_RS00375 | 84044..84262 | - | 219 | WP_141406477.1 | hypothetical protein | - |
| I6I08_RS00380 | 84366..85034 | - | 669 | WP_141406478.1 | hypothetical protein | - |
| I6I08_RS00385 | 85060..85455 | - | 396 | WP_170198595.1 | hypothetical protein | - |
| I6I08_RS00390 | 85452..85805 | - | 354 | WP_141406480.1 | HK97 gp10 family phage protein | - |
| I6I08_RS00395 | 85809..86153 | - | 345 | WP_141406481.1 | hypothetical protein | - |
| I6I08_RS00400 | 86150..86719 | - | 570 | WP_141406482.1 | hypothetical protein | - |
| I6I08_RS00405 | 86752..86961 | - | 210 | WP_141406483.1 | hypothetical protein | - |
| I6I08_RS00410 | 86963..87814 | - | 852 | WP_170198596.1 | hypothetical protein | - |
| I6I08_RS00415 | 87841..88440 | - | 600 | WP_170198597.1 | hypothetical protein | - |
| I6I08_RS00420 | 88653..89912 | - | 1260 | WP_141406485.1 | hypothetical protein | - |
| I6I08_RS00425 | 89934..91358 | - | 1425 | WP_198498132.1 | phage portal protein | - |
| I6I08_RS00430 | 91367..93040 | - | 1674 | WP_141406486.1 | terminase | - |
| I6I08_RS00435 | 93059..93445 | - | 387 | WP_141406487.1 | hypothetical protein | - |
| I6I08_RS00440 | 93611..94177 | + | 567 | WP_141406488.1 | DNA primase | - |
| I6I08_RS00445 | 94488..94631 | + | 144 | WP_170198598.1 | hypothetical protein | - |
| I6I08_RS00450 | 94849..95208 | + | 360 | WP_141406489.1 | hypothetical protein | - |
| I6I08_RS00455 | 95280..95510 | - | 231 | WP_141406490.1 | hypothetical protein | - |
| I6I08_RS00460 | 95507..96343 | - | 837 | WP_141406491.1 | hypothetical protein | - |
| I6I08_RS00465 | 96372..97769 | - | 1398 | WP_141406492.1 | hypothetical protein | - |
| I6I08_RS00470 | 97865..98425 | - | 561 | WP_141406493.1 | single-stranded DNA-binding protein | - |
| I6I08_RS00475 | 98501..99088 | - | 588 | WP_141406494.1 | hypothetical protein | - |
| I6I08_RS00480 | 99107..99511 | - | 405 | WP_141406495.1 | hypothetical protein | - |
| I6I08_RS00485 | 99472..99714 | - | 243 | WP_141406496.1 | hypothetical protein | - |
| I6I08_RS00490 | 99711..100118 | - | 408 | WP_141406497.1 | hypothetical protein | - |
| I6I08_RS00495 | 100115..100405 | - | 291 | WP_141406498.1 | hypothetical protein | - |
| I6I08_RS00500 | 100402..101040 | - | 639 | WP_141406499.1 | hypothetical protein | - |
| I6I08_RS00505 | 101037..101951 | - | 915 | WP_141406500.1 | hypothetical protein | - |
| I6I08_RS00510 | 101948..103789 | - | 1842 | WP_141406501.1 | ParB N-terminal domain-containing protein | - |
| I6I08_RS00515 | 104585..104950 | - | 366 | WP_141406502.1 | hypothetical protein | - |
| I6I08_RS00520 | 105104..105358 | - | 255 | WP_141406503.1 | helix-turn-helix domain-containing protein | - |
| I6I08_RS00525 | 105355..105648 | - | 294 | WP_141406504.1 | hypothetical protein | - |
| I6I08_RS00530 | 105648..105977 | - | 330 | WP_141406505.1 | helix-turn-helix transcriptional regulator | - |
| I6I08_RS00535 | 106059..106562 | + | 504 | WP_141406506.1 | hypothetical protein | - |
| I6I08_RS00540 | 106696..107130 | + | 435 | WP_141406507.1 | hypothetical protein | - |
| I6I08_RS00545 | 107197..107766 | - | 570 | WP_170198600.1 | DUF2335 domain-containing protein | - |
| I6I08_RS00550 | 107869..108888 | - | 1020 | WP_170198601.1 | tyrosine-type recombinase/integrase | - |
| I6I08_RS00560 | 109513..110175 | + | 663 | WP_141406510.1 | hypothetical protein | - |
| I6I08_RS00565 | 110513..113473 | + | 2961 | WP_141406511.1 | RNA degradosome polyphosphate kinase | - |
| I6I08_RS00570 | 113486..114514 | + | 1029 | WP_141406512.1 | NUDIX hydrolase | - |
| I6I08_RS00575 | 114527..114817 | - | 291 | WP_141406513.1 | cell surface protein | - |
| I6I08_RS00580 | 114999..116072 | + | 1074 | WP_141406514.1 | phosphate ABC transporter substrate-binding protein PstS | - |
| I6I08_RS00585 | 116167..117183 | + | 1017 | WP_075414083.1 | phosphate ABC transporter permease subunit PstC | - |
| I6I08_RS00590 | 117185..118408 | + | 1224 | WP_198498133.1 | phosphate ABC transporter permease PstA | - |
| I6I08_RS00595 | 118498..119277 | + | 780 | WP_003781705.1 | phosphate ABC transporter ATP-binding protein | - |
| I6I08_RS00600 | 119721..120392 | - | 672 | WP_075374805.1 | response regulator transcription factor | - |
| I6I08_RS00605 | 120600..121736 | + | 1137 | WP_075378692.1 | hypothetical protein | - |
| I6I08_RS00610 | 122039..122788 | + | 750 | WP_060957315.1 | FABP family protein | - |
| I6I08_RS00615 | 122788..124032 | + | 1245 | WP_141406515.1 | folate-binding protein YgfZ | - |
| I6I08_RS00620 | 124260..124649 | + | 390 | WP_075414079.1 | DUF2516 family protein | - |
| I6I08_RS00625 | 124649..125077 | + | 429 | WP_075378689.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| I6I08_RS00630 | 125117..125623 | + | 507 | WP_075378688.1 | DUF3995 domain-containing protein | - |
| I6I08_RS00635 | 125797..126834 | - | 1038 | WP_141406516.1 | pyridoxal-phosphate dependent enzyme | - |
| I6I08_RS00640 | 126917..127834 | + | 918 | WP_141406517.1 | LysR family transcriptional regulator | - |
| I6I08_RS00645 | 127887..128870 | + | 984 | WP_141406518.1 | ribokinase | - |
| I6I08_RS00650 | 128984..129787 | - | 804 | WP_141406660.1 | hypothetical protein | - |
| I6I08_RS00655 | 130195..132360 | - | 2166 | WP_141406519.1 | MFS transporter | - |
| I6I08_RS00660 | 132434..133384 | - | 951 | WP_141406520.1 | hypothetical protein | - |
| I6I08_RS00665 | 133381..135429 | - | 2049 | WP_141406521.1 | hypothetical protein | - |
| I6I08_RS00670 | 135449..136771 | - | 1323 | WP_141406522.1 | hypothetical protein | - |
| I6I08_RS00675 | 136851..137570 | + | 720 | WP_141406523.1 | permease | - |
| I6I08_RS00680 | 137602..138318 | + | 717 | WP_003780993.1 | response regulator transcription factor | - |
| I6I08_RS00685 | 138369..139424 | + | 1056 | WP_141406661.1 | HAMP domain-containing histidine kinase | - |
| I6I08_RS00690 | 139482..140966 | + | 1485 | WP_141406524.1 | multicopper oxidase family protein | - |
| I6I08_RS00695 | 141154..141450 | + | 297 | WP_009400031.1 | hypothetical protein | - |
| I6I08_RS00700 | 141496..143973 | + | 2478 | WP_141406525.1 | copper-translocating P-type ATPase | - |
| I6I08_RS00705 | 143999..144811 | - | 813 | WP_141406526.1 | IS21-like element helper ATPase IstB | - |
| I6I08_RS00710 | 144808..146346 | - | 1539 | Protein_138 | IS21 family transposase | - |
| I6I08_RS00715 | 146486..148594 | - | 2109 | WP_141406527.1 | hypothetical protein | - |
| I6I08_RS00720 | 148614..149912 | - | 1299 | WP_141406528.1 | hypothetical protein | - |
| I6I08_RS00725 | 149909..152011 | - | 2103 | WP_141406529.1 | hypothetical protein | - |
| I6I08_RS00730 | 152601..155201 | + | 2601 | WP_003787373.1 | ATP-dependent Clp protease ATP-binding subunit | - |
| I6I08_RS00735 | 155788..157236 | + | 1449 | WP_141406530.1 | hypothetical protein | - |
| I6I08_RS00740 | 157233..159812 | + | 2580 | WP_141406531.1 | GT4 family glycosyltransferase PelF | - |
| I6I08_RS00745 | 159809..160918 | + | 1110 | WP_009407206.1 | hypothetical protein | - |
| I6I08_RS00750 | 161121..162533 | + | 1413 | WP_075378676.1 | MFS transporter | - |
| I6I08_RS00755 | 162562..163008 | + | 447 | WP_075375602.1 | universal stress protein | - |
| I6I08_RS00760 | 163735..166440 | + | 2706 | WP_075378675.1 | pyruvate, phosphate dikinase | - |
| I6I08_RS00765 | 166506..167984 | - | 1479 | WP_141406532.1 | esterase | - |
| I6I08_RS00770 | 167977..170523 | - | 2547 | WP_075378673.1 | DUF2156 domain-containing protein | - |
| I6I08_RS00775 | 170935..172932 | + | 1998 | WP_075378672.1 | hypothetical protein | - |
| I6I08_RS00780 | 172973..174043 | - | 1071 | WP_141406533.1 | alpha/beta hydrolase | - |
| I6I08_RS00785 | 174359..175840 | + | 1482 | WP_141406534.1 | sugar porter family MFS transporter | - |
| I6I08_RS00790 | 175875..177446 | + | 1572 | WP_198498134.1 | sulfatase-like hydrolase/transferase | - |
| I6I08_RS00795 | 177554..178762 | + | 1209 | WP_141406535.1 | ROK family protein | - |
| I6I08_RS00800 | 178852..180132 | + | 1281 | WP_198498161.1 | anaerobic sulfatase maturase | - |
| I6I08_RS00805 | 180139..180924 | + | 786 | WP_141406537.1 | sulfite exporter TauE/SafE family protein | - |
| I6I08_RS00810 | 181014..181340 | + | 327 | WP_141406663.1 | HigA family addiction module antidote protein | - |
| I6I08_RS00815 | 181378..182832 | + | 1455 | WP_141406538.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| I6I08_RS00820 | 182937..183386 | + | 450 | WP_075378668.1 | RpiB/LacA/LacB family sugar-phosphate isomerase | - |
| I6I08_RS00825 | 183562..183909 | + | 348 | WP_141406540.1 | VOC family protein | - |
| I6I08_RS00830 | 184223..184879 | + | 657 | WP_141406541.1 | TetR/AcrR family transcriptional regulator | - |
| I6I08_RS00835 | 184976..186691 | + | 1716 | WP_141406542.1 | MFS transporter | - |
| I6I08_RS00840 | 186720..188924 | - | 2205 | WP_141406543.1 | hypothetical protein | - |
| I6I08_RS00845 | 189173..189667 | + | 495 | WP_141406544.1 | isoprenylcysteine carboxylmethyltransferase family protein | - |
| I6I08_RS00850 | 189751..190818 | + | 1068 | WP_141406545.1 | LLM class flavin-dependent oxidoreductase | - |
| I6I08_RS00855 | 190900..191316 | + | 417 | Protein_167 | hypothetical protein | - |
| I6I08_RS00860 | 191498..191710 | + | 213 | WP_003780572.1 | hypothetical protein | - |
| I6I08_RS00865 | 191710..191925 | + | 216 | WP_060957359.1 | hypothetical protein | - |
| I6I08_RS00870 | 191982..193403 | + | 1422 | WP_141406546.1 | plasmid replication-like protein | - |
| I6I08_RS00875 | 193400..193990 | + | 591 | WP_009212769.1 | hypothetical protein | - |
| I6I08_RS00880 | 193987..195273 | + | 1287 | WP_141406547.1 | relaxase/mobilization nuclease domain-containing protein | - |
| I6I08_RS00885 | 195224..195766 | + | 543 | WP_003780585.1 | hypothetical protein | - |
| I6I08_RS00890 | 195855..196223 | + | 369 | WP_003780589.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| I6I08_RS00895 | 196220..198124 | + | 1905 | WP_029574305.1 | cadmium-translocating P-type ATPase | - |
| I6I08_RS00900 | 198153..198977 | + | 825 | WP_141406548.1 | LLM class flavin-dependent oxidoreductase | - |
| I6I08_RS00905 | 199026..199756 | + | 731 | Protein_177 | arsenic resistance protein | - |
| I6I08_RS00910 | 200331..201689 | + | 1359 | WP_141406549.1 | PAS domain-containing protein | - |
| I6I08_RS00915 | 201715..203004 | - | 1290 | WP_141406664.1 | M48 family metallopeptidase | - |
| I6I08_RS00920 | 203375..204094 | + | 720 | WP_141406665.1 | peptidyl-tRNA hydrolase | - |
| I6I08_RS00925 | 204353..204916 | - | 564 | WP_141406550.1 | GtrA family protein | - |
| I6I08_RS00930 | 205013..205666 | - | 654 | WP_141406551.1 | HAD-IA family hydrolase | - |
| I6I08_RS00935 | 205749..207083 | + | 1335 | WP_141406552.1 | M18 family aminopeptidase | - |
| I6I08_RS00940 | 207086..207541 | + | 456 | WP_141406553.1 | SEC-C domain-containing protein | - |
| I6I08_RS00945 | 207591..208631 | - | 1041 | WP_141406554.1 | zinc-binding alcohol dehydrogenase family protein | - |
| I6I08_RS00950 | 208941..209276 | - | 336 | WP_141406555.1 | helix-turn-helix transcriptional regulator | - |
| I6I08_RS00955 | 209415..210521 | - | 1107 | WP_141406556.1 | NADH:flavin oxidoreductase/NADH oxidase | - |
| I6I08_RS00960 | 210781..211665 | + | 885 | WP_141406666.1 | patatin family protein | - |
| I6I08_RS00965 | 211668..212234 | - | 567 | WP_141406557.1 | NUDIX domain-containing protein | - |
| I6I08_RS00970 | 212623..213648 | + | 1026 | WP_141406558.1 | alpha/beta hydrolase | - |
| I6I08_RS00975 | 213780..214367 | + | 588 | WP_141406559.1 | biotin transporter BioY | - |
| I6I08_RS00980 | 214482..215597 | + | 1116 | WP_141406560.1 | LLM class flavin-dependent oxidoreductase | - |
| I6I08_RS00985 | 215761..217386 | + | 1626 | WP_141406561.1 | peptide ABC transporter substrate-binding protein | - |
| I6I08_RS00990 | 217406..218335 | + | 930 | WP_141406562.1 | ABC transporter permease | - |
| I6I08_RS00995 | 218328..219287 | + | 960 | WP_141406563.1 | ABC transporter permease | - |
| I6I08_RS01000 | 219284..221167 | + | 1884 | WP_141406564.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS01005 | 221408..222367 | + | 960 | WP_003787284.1 | ABC transporter permease | - |
| I6I08_RS01010 | 222398..223384 | + | 987 | WP_141406667.1 | ABC transporter permease | - |
| I6I08_RS01015 | 223381..225588 | + | 2208 | WP_141406565.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS01020 | 225708..227375 | + | 1668 | WP_141406566.1 | ABC transporter family substrate-binding protein | - |
| I6I08_RS01025 | 227437..228144 | + | 708 | WP_141406567.1 | hypothetical protein | - |
| I6I08_RS01030 | 228220..229422 | + | 1203 | WP_170198602.1 | MFS transporter | - |
| I6I08_RS01035 | 229631..231553 | + | 1923 | WP_075379182.1 | translational GTPase TypA | - |
| I6I08_RS01040 | 231569..234397 | + | 2829 | WP_141406569.1 | VanW family protein | - |
| I6I08_RS01045 | 234686..235036 | + | 351 | WP_009394099.1 | ferredoxin family protein | - |
| I6I08_RS01050 | 235091..236299 | + | 1209 | WP_170198603.1 | succinyldiaminopimelate transaminase | - |
| I6I08_RS01055 | 236575..237996 | + | 1422 | WP_141406571.1 | citrate synthase | - |
| I6I08_RS01060 | 238391..238639 | - | 249 | WP_075379185.1 | ribbon-helix-helix domain-containing protein | - |
| I6I08_RS01065 | 238705..239553 | - | 849 | WP_075379186.1 | VOC family protein | - |
| I6I08_RS01070 | 239650..239856 | - | 207 | Protein_210 | LPXTG cell wall anchor domain-containing protein | - |
| I6I08_RS01075 | 240064..241218 | - | 1155 | WP_170198604.1 | MFS transporter | - |
| I6I08_RS01080 | 241323..241682 | + | 360 | WP_075378600.1 | MerR family transcriptional regulator | - |
| I6I08_RS01085 | 241855..242682 | + | 828 | WP_141406572.1 | class I SAM-dependent methyltransferase | - |
| I6I08_RS01090 | 242853..243842 | + | 990 | WP_141406573.1 | IS481 family transposase | - |
| I6I08_RS01095 | 243926..244681 | - | 756 | WP_141406574.1 | succinate dehydrogenase/fumarate reductase iron-sulfur subunit | - |
| I6I08_RS01100 | 244678..246639 | - | 1962 | WP_141406575.1 | fumarate reductase/succinate dehydrogenase flavoprotein subunit | - |
| I6I08_RS01105 | 246636..247415 | - | 780 | WP_081379345.1 | succinate dehydrogenase cytochrome b subunit | - |
| I6I08_RS01110 | 247598..248581 | - | 984 | WP_141406576.1 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | - |
| I6I08_RS01115 | 248642..249382 | + | 741 | WP_141406577.1 | histidine phosphatase family protein | - |
| I6I08_RS01120 | 249505..250149 | + | 645 | WP_141406669.1 | hypothetical protein | - |
| I6I08_RS01125 | 250195..250638 | - | 444 | WP_141406578.1 | PLD nuclease N-terminal domain-containing protein | - |
| I6I08_RS01130 | 250748..252112 | + | 1365 | WP_141406579.1 | AMP-binding protein | - |
| I6I08_RS01135 | 252096..253028 | - | 933 | WP_141406580.1 | kinase | - |
| I6I08_RS01140 | 253025..254086 | - | 1062 | WP_141406581.1 | ADP-ribosylglycohydrolase family protein | - |
| I6I08_RS01145 | 254264..255244 | + | 981 | WP_141406582.1 | 1,4-dihydroxy-2-naphthoate polyprenyltransferase | - |
| I6I08_RS01150 | 255272..256045 | + | 774 | WP_075378494.1 | hypothetical protein | - |
| I6I08_RS01155 | 256601..257182 | - | 582 | WP_075378495.1 | DUF1440 domain-containing protein | - |
| I6I08_RS01160 | 257459..257995 | - | 537 | WP_075378496.1 | hypothetical protein | - |
| I6I08_RS01165 | 258220..259926 | + | 1707 | WP_075378497.1 | redoxin family protein | - |
| I6I08_RS01170 | 259966..260598 | + | 633 | WP_081379346.1 | sigma-70 family RNA polymerase sigma factor | - |
| I6I08_RS01175 | 260595..261536 | + | 942 | WP_075378498.1 | anti-sigma factor | - |
| I6I08_RS01180 | 261921..263000 | - | 1080 | WP_141406583.1 | 1,4-dihydroxy-2-naphthoyl-CoA synthase | - |
| I6I08_RS01185 | 263066..263737 | - | 672 | WP_003787214.1 | response regulator transcription factor | - |
| I6I08_RS01190 | 263730..264941 | - | 1212 | WP_141406584.1 | hypothetical protein | - |
| I6I08_RS01195 | 265059..265253 | - | 195 | WP_101585841.1 | hypothetical protein | - |
| I6I08_RS01200 | 265449..266792 | + | 1344 | WP_141406585.1 | arginine deiminase | - |
| I6I08_RS01205 | 266812..268053 | - | 1242 | WP_198498162.1 | GHMP kinase | - |
| I6I08_RS01210 | 268074..268916 | - | 843 | WP_020991768.1 | NTP transferase domain-containing protein | - |
| I6I08_RS01215 | 268939..270357 | - | 1419 | WP_003787203.1 | phosphoglucomutase/phosphomannomutase family protein | - |
| I6I08_RS01220 | 270446..271309 | - | 864 | WP_141406586.1 | carbohydrate ABC transporter permease | - |
| I6I08_RS01225 | 271306..272259 | - | 954 | WP_003787199.1 | sugar ABC transporter permease | - |
| I6I08_RS01230 | 272326..273639 | - | 1314 | WP_070510574.1 | extracellular solute-binding protein | - |
| I6I08_RS01235 | 273761..275971 | - | 2211 | WP_141406587.1 | 1,3-beta-galactosyl-N-acetylhexosamine phosphorylase | - |
| I6I08_RS01240 | 276069..277265 | - | 1197 | WP_170198609.1 | ROK family transcriptional regulator | - |
| I6I08_RS01245 | 277925..279145 | + | 1221 | WP_141406671.1 | glycine betaine/L-proline ABC transporter ATP-binding protein | - |
| I6I08_RS01250 | 279145..280023 | + | 879 | WP_075378509.1 | proline/glycine betaine ABC transporter permease | - |
| I6I08_RS01255 | 280090..280965 | + | 876 | WP_141406589.1 | glycine betaine ABC transporter substrate-binding protein | - |
| I6I08_RS01260 | 281210..281794 | - | 585 | WP_141406590.1 | hypothetical protein | - |
| I6I08_RS01265 | 281897..282397 | - | 501 | WP_040321721.1 | hypothetical protein | - |
| I6I08_RS01270 | 282684..283784 | + | 1101 | WP_141406591.1 | o-succinylbenzoate synthase | - |
| I6I08_RS01275 | 283909..285681 | + | 1773 | WP_141406672.1 | 2-succinyl-5-enolpyruvyl-6-hydroxy-3- cyclohexene-1-carboxylic-acid synthase | - |
| I6I08_RS01280 | 285893..287596 | + | 1704 | WP_170198605.1 | trypsin-like peptidase domain-containing protein | - |
| I6I08_RS01285 | 287618..287959 | - | 342 | WP_141406673.1 | hypothetical protein | - |
| I6I08_RS01290 | 288674..288916 | - | 243 | WP_198498135.1 | hypothetical protein | - |
| I6I08_RS01295 | 289026..290396 | - | 1371 | WP_141406593.1 | isochorismate synthase | - |
| I6I08_RS01300 | 290431..291156 | - | 726 | WP_141406594.1 | demethylmenaquinone methyltransferase | - |
| I6I08_RS01305 | 291534..292835 | + | 1302 | WP_101558708.1 | geranylgeranyl reductase family protein | - |
| I6I08_RS01310 | 292832..293191 | + | 360 | WP_003787163.1 | NADH-quinone oxidoreductase subunit A | - |
| I6I08_RS01315 | 293254..293868 | + | 615 | WP_175284728.1 | NADH-quinone oxidoreductase subunit B | - |
| I6I08_RS01320 | 293865..294641 | + | 777 | WP_141406595.1 | NADH-quinone oxidoreductase subunit C | - |
| I6I08_RS01325 | 294641..296029 | + | 1389 | WP_141406596.1 | NADH-quinone oxidoreductase subunit D | - |
| I6I08_RS01330 | 296029..296799 | + | 771 | WP_141406597.1 | NADH-quinone oxidoreductase subunit NuoE | - |
| I6I08_RS01335 | 296796..298127 | + | 1332 | WP_101558704.1 | NADH-quinone oxidoreductase subunit NuoF | - |
| I6I08_RS01340 | 298131..300880 | + | 2750 | Protein_264 | NADH-quinone oxidoreductase subunit G | - |
| I6I08_RS01345 | 300877..302517 | + | 1641 | WP_075378520.1 | NADH-quinone oxidoreductase subunit NuoH | - |
| I6I08_RS01350 | 302510..303211 | + | 702 | WP_075378521.1 | NADH-quinone oxidoreductase subunit NuoI | - |
| I6I08_RS01355 | 303208..304209 | + | 1002 | WP_141406598.1 | NADH-quinone oxidoreductase subunit J | - |
| I6I08_RS01360 | 304206..304511 | + | 306 | WP_003787144.1 | NADH-quinone oxidoreductase subunit NuoK | - |
| I6I08_RS01365 | 304529..306523 | + | 1995 | WP_075378523.1 | NADH-quinone oxidoreductase subunit L | - |
| I6I08_RS01370 | 306537..308141 | + | 1605 | WP_075378524.1 | NADH-quinone oxidoreductase subunit M | - |
| I6I08_RS01375 | 308138..309751 | + | 1614 | WP_075378525.1 | NADH-quinone oxidoreductase subunit NuoN | - |
| I6I08_RS01380 | 309748..310854 | + | 1107 | WP_141406599.1 | polyprenyl synthetase family protein | - |
| I6I08_RS01385 | 311223..312602 | + | 1380 | WP_141406674.1 | OmpA family protein | - |
| I6I08_RS01390 | 312615..315185 | - | 2571 | WP_141406600.1 | HNH endonuclease | - |
| I6I08_RS01395 | 315650..317137 | + | 1488 | WP_009406996.1 | FAD-dependent oxidoreductase | - |
| I6I08_RS01400 | 317252..317836 | + | 585 | WP_075378528.1 | GNAT family N-acetyltransferase | - |
| I6I08_RS01405 | 317870..318739 | + | 870 | WP_141406601.1 | zinc metalloprotease HtpX | - |
| I6I08_RS01410 | 318743..319285 | + | 543 | WP_141406602.1 | AAA family ATPase | - |
| I6I08_RS01415 | 319282..320298 | + | 1017 | WP_141406603.1 | phosphotransferase | - |
| I6I08_RS01420 | 320394..321659 | + | 1266 | WP_141406604.1 | sensor histidine kinase | - |
| I6I08_RS01425 | 321647..322291 | + | 645 | WP_070512283.1 | response regulator transcription factor | - |
| I6I08_RS01430 | 322312..322809 | - | 498 | WP_003787109.1 | YajQ family cyclic di-GMP-binding protein | - |
| I6I08_RS01450 | 323376..323576 | + | 201 | WP_009395479.1 | 50S ribosomal protein L33 | - |
| I6I08_RS01455 | 323662..324486 | + | 825 | WP_075378531.1 | hypothetical protein | - |
| I6I08_RS01460 | 324992..325663 | + | 672 | WP_020991756.1 | MarR family transcriptional regulator | - |
| I6I08_RS01465 | 325677..326342 | - | 666 | WP_075378532.1 | septum formation inhibitor Maf | - |
| I6I08_RS01470 | 326377..327294 | + | 918 | WP_075378533.1 | hypothetical protein | - |
| I6I08_RS01475 | 327384..328532 | + | 1149 | WP_075378534.1 | adenylate/guanylate cyclase domain-containing protein | - |
| I6I08_RS01480 | 328750..329421 | + | 672 | WP_009406998.1 | response regulator transcription factor | - |
| I6I08_RS01485 | 329508..330584 | + | 1077 | WP_075378535.1 | HAMP domain-containing histidine kinase | - |
| I6I08_RS01490 | 330636..331349 | - | 714 | WP_075378536.1 | VTT domain-containing protein | - |
| I6I08_RS01495 | 331461..332021 | - | 561 | WP_075378537.1 | GtrA family protein | - |
| I6I08_RS01500 | 332062..333333 | - | 1272 | WP_075378605.1 | hypothetical protein | - |
| I6I08_RS01505 | 333400..334695 | + | 1296 | WP_075378538.1 | ATP-grasp domain-containing protein | - |
| I6I08_RS01510 | 334770..335321 | + | 552 | WP_075378539.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
| I6I08_RS01515 | 336181..337170 | + | 990 | WP_075378540.1 | UDP-glucose 4-epimerase GalE | - |
| I6I08_RS01520 | 337255..338325 | - | 1071 | WP_170198610.1 | LCP family protein | - |
| I6I08_RS01525 | 338767..340053 | - | 1287 | WP_020991754.1 | LCP family protein | - |
| I6I08_RS01530 | 340275..341114 | + | 840 | WP_075378542.1 | glycosyltransferase family 2 protein | - |
| I6I08_RS01535 | 341150..341563 | - | 414 | WP_075378543.1 | DUF2304 domain-containing protein | - |
| I6I08_RS01540 | 341586..342302 | - | 717 | WP_075378544.1 | glycosyltransferase family 2 protein | - |
| I6I08_RS01545 | 342700..343959 | + | 1260 | WP_075378606.1 | glycosyltransferase | - |
| I6I08_RS01550 | 344180..344836 | + | 657 | WP_075378545.1 | N-acetyltransferase | - |
| I6I08_RS01555 | 344836..345969 | + | 1134 | WP_075378546.1 | DegT/DnrJ/EryC1/StrS family aminotransferase | - |
| I6I08_RS01560 | 345971..347038 | + | 1068 | WP_003787084.1 | Gfo/Idh/MocA family oxidoreductase | - |
| I6I08_RS01565 | 347065..348414 | + | 1350 | WP_075378547.1 | oligosaccharide flippase family protein | - |
| I6I08_RS01570 | 348408..349526 | - | 1119 | WP_075378548.1 | glycosyltransferase family 4 protein | - |
| I6I08_RS01575 | 349556..350638 | - | 1083 | WP_075378549.1 | UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing) | - |
| I6I08_RS01580 | 350929..352083 | + | 1155 | WP_075378550.1 | glycosyltransferase | - |
| I6I08_RS01585 | 352080..353501 | + | 1422 | WP_075378551.1 | glycosyltransferase | - |
| I6I08_RS01590 | 353498..355600 | + | 2103 | WP_141406605.1 | Tat pathway signal sequence | - |
| I6I08_RS01595 | 355656..357152 | - | 1497 | WP_170198611.1 | 7-cyano-7-deazaguanine synthase | - |
| I6I08_RS01600 | 357429..358733 | + | 1305 | WP_141406606.1 | nucleotide sugar dehydrogenase | - |
| I6I08_RS01605 | 358765..360831 | + | 2067 | WP_141406607.1 | hypothetical protein | - |
| I6I08_RS01610 | 360853..361137 | - | 285 | WP_141406608.1 | antibiotic biosynthesis monooxygenase | - |
| I6I08_RS01615 | 361255..362250 | - | 996 | WP_141406676.1 | dTDP-glucose 4,6-dehydratase | - |
| I6I08_RS01620 | 362661..365141 | + | 2481 | WP_141406609.1 | N-acetylmuramoyl-L-alanine amidase | - |
| I6I08_RS01625 | 365265..367307 | + | 2043 | WP_141406610.1 | rhamnan synthesis protein F | - |
| I6I08_RS01630 | 367435..368460 | + | 1026 | WP_003787064.1 | glycosyltransferase family 2 protein | - |
| I6I08_RS01635 | 368457..368924 | + | 468 | WP_075374382.1 | GtrA family protein | - |
| I6I08_RS01640 | 368914..370923 | + | 2010 | WP_075378557.1 | hypothetical protein | - |
| I6I08_RS01645 | 370959..371801 | + | 843 | WP_075374384.1 | NAD(P)-dependent oxidoreductase | - |
| I6I08_RS01650 | 371876..373756 | + | 1881 | WP_070510634.1 | rhamnan synthesis F family protein | - |
| I6I08_RS01655 | 373753..374859 | + | 1107 | WP_075374385.1 | acyltransferase | - |
| I6I08_RS01660 | 375044..376138 | + | 1095 | WP_141406611.1 | NAD-dependent epimerase/dehydratase family protein | - |
| I6I08_RS01665 | 376143..377009 | + | 867 | WP_141406612.1 | ABC transporter permease | - |
| I6I08_RS01670 | 377018..378319 | + | 1302 | WP_141406613.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS01675 | 378347..379420 | - | 1074 | WP_141406614.1 | glycosyltransferase family 2 protein | - |
| I6I08_RS01680 | 379557..380567 | - | 1011 | WP_141406615.1 | glycosyltransferase family 2 protein | - |
| I6I08_RS01685 | 380564..381670 | - | 1107 | WP_141406677.1 | glycosyltransferase family 4 protein | - |
| I6I08_RS01690 | 381844..382965 | + | 1122 | WP_101558649.1 | glycosyltransferase family 4 protein | - |
| I6I08_RS01695 | 383114..384043 | + | 930 | WP_141406616.1 | NAD(P)-dependent oxidoreductase | - |
| I6I08_RS01700 | 384098..385663 | + | 1566 | WP_141406617.1 | DUF2142 domain-containing protein | - |
| I6I08_RS01705 | 385755..386627 | - | 873 | WP_141406618.1 | glucose-1-phosphate thymidylyltransferase RfbA | - |
| I6I08_RS01710 | 386831..387412 | + | 582 | WP_141406619.1 | dTDP-4-dehydrorhamnose 3,5-epimerase | - |
| I6I08_RS01715 | 387445..388635 | + | 1191 | WP_141406620.1 | mannose-6-phosphate isomerase, class I | - |
| I6I08_RS01720 | 388668..389459 | - | 792 | WP_141406621.1 | hypothetical protein | - |
| I6I08_RS01725 | 389893..390108 | + | 216 | WP_171971931.1 | WhiB family transcriptional regulator | - |
| I6I08_RS01730 | 390105..394154 | + | 4050 | WP_141406622.1 | glycosyltransferase | - |
| I6I08_RS01735 | 394151..396106 | + | 1956 | WP_141406623.1 | hypothetical protein | - |
| I6I08_RS01740 | 396137..396439 | - | 303 | WP_050798055.1 | metallopeptidase family protein | - |
| I6I08_RS01745 | 396674..397108 | + | 435 | WP_003787014.1 | DUF3499 domain-containing protein | - |
| I6I08_RS01750 | 397105..397344 | + | 240 | WP_003787012.1 | hypothetical protein | - |
| I6I08_RS01755 | 397403..398284 | - | 882 | WP_141406624.1 | RDD family protein | - |
| I6I08_RS01760 | 398299..399294 | + | 996 | WP_075378577.1 | stage II sporulation protein M | - |
| I6I08_RS01765 | 399318..400610 | - | 1293 | WP_141406625.1 | DUF58 domain-containing protein | - |
| I6I08_RS01770 | 400676..401779 | - | 1104 | WP_141406626.1 | MoxR family ATPase | - |
| I6I08_RS01775 | 401776..402987 | - | 1212 | WP_141406627.1 | DUF4350 domain-containing protein | - |
| I6I08_RS01780 | 402984..403670 | - | 687 | WP_141406628.1 | DUF4129 domain-containing protein | - |
| I6I08_RS01785 | 403678..404997 | - | 1320 | WP_141406629.1 | hypothetical protein | - |
| I6I08_RS01790 | 405266..405946 | + | 681 | WP_003786992.1 | response regulator transcription factor | - |
| I6I08_RS01795 | 405981..407864 | + | 1884 | WP_141406630.1 | HAMP domain-containing histidine kinase | - |
| I6I08_RS01800 | 407861..409666 | + | 1806 | WP_198498136.1 | GerMN domain-containing protein | - |
| I6I08_RS01805 | 409783..410430 | - | 648 | WP_141406632.1 | ribosome-associated translation inhibitor RaiA | - |
| I6I08_RS01810 | 410647..411567 | - | 921 | WP_141406633.1 | ComF family protein | - |
| I6I08_RS01815 | 411898..414729 | + | 2832 | WP_003786982.1 | preprotein translocase subunit SecA | - |
| I6I08_RS01820 | 414801..415316 | - | 516 | WP_141406634.1 | hypothetical protein | - |
| I6I08_RS01825 | 415426..416271 | - | 846 | WP_141406635.1 | LysM peptidoglycan-binding domain-containing protein | - |
| I6I08_RS01830 | 416452..417000 | + | 549 | WP_141406636.1 | Fis family transcriptional regulator | - |
| I6I08_RS01835 | 417024..417248 | - | 225 | WP_003786975.1 | helix-turn-helix domain-containing protein | - |
| I6I08_RS01840 | 417449..418129 | + | 681 | WP_141406637.1 | hypothetical protein | - |
| I6I08_RS01845 | 418126..419997 | + | 1872 | WP_141406638.1 | hypothetical protein | - |
| I6I08_RS01850 | 420082..420564 | + | 483 | WP_141406639.1 | hypothetical protein | - |
| I6I08_RS01855 | 420910..421431 | + | 522 | WP_009407225.1 | 50S ribosomal protein L10 | - |
| I6I08_RS01860 | 421495..421884 | + | 390 | WP_009747839.1 | 50S ribosomal protein L7/L12 | - |
| I6I08_RS01865 | 422214..423335 | - | 1122 | WP_141406640.1 | hypothetical protein | - |
| I6I08_RS01870 | 424031..427552 | + | 3522 | WP_141406641.1 | DNA-directed RNA polymerase subunit beta | - |
| I6I08_RS01875 | 427733..431686 | + | 3954 | WP_009407052.1 | DNA-directed RNA polymerase subunit beta' | - |
| I6I08_RS01880 | 431812..432768 | - | 957 | WP_141406642.1 | DUF4862 family protein | - |
| I6I08_RS01885 | 432917..435349 | + | 2433 | WP_141406643.1 | exo-alpha-sialidase | - |
| I6I08_RS01890 | 435421..437634 | + | 2214 | WP_141406644.1 | beta-galactosidase | - |
| I6I08_RS01895 | 437736..438794 | + | 1059 | WP_141406645.1 | hypothetical protein | - |
| I6I08_RS01900 | 439160..441786 | + | 2627 | Protein_373 | hypothetical protein | - |
| I6I08_RS01905 | 441853..445308 | - | 3456 | WP_141406646.1 | SMC family ATPase | - |
| I6I08_RS01910 | 445305..446630 | - | 1326 | WP_141406647.1 | exonuclease subunit SbcD | - |
| I6I08_RS01915 | 446682..450074 | - | 3393 | WP_198498137.1 | tetratricopeptide repeat protein | - |
| I6I08_RS01920 | 450112..450246 | - | 135 | Protein_377 | exonuclease SbcCD subunit D | - |
| I6I08_RS01925 | 450298..453288 | - | 2991 | WP_141406679.1 | tetratricopeptide repeat protein | - |
| I6I08_RS01930 | 453331..455757 | - | 2427 | WP_141406680.1 | tetratricopeptide repeat protein | - |
| I6I08_RS01935 | 456059..456340 | - | 282 | WP_020991728.1 | hypothetical protein | - |
| I6I08_RS01940 | 456662..457498 | - | 837 | WP_003786934.1 | undecaprenyl-diphosphate phosphatase | - |
| I6I08_RS01945 | 457746..458858 | - | 1113 | WP_003786932.1 | ATP-binding protein | - |
| I6I08_RS01950 | 458966..459859 | - | 894 | WP_003786930.1 | histidinol-phosphatase | - |
| I6I08_RS01955 | 460131..461453 | + | 1323 | WP_020991727.1 | NAD(P)H-dependent oxidoreductase | - |
| I6I08_RS01960 | 461547..462041 | + | 495 | WP_070510908.1 | GNAT family N-acetyltransferase | - |
| I6I08_RS01965 | 462124..462675 | - | 552 | WP_141406681.1 | NAD(P)H-dependent oxidoreductase | - |
| I6I08_RS01970 | 462722..463744 | - | 1023 | WP_141406808.1 | zinc-dependent alcohol dehydrogenase family protein | - |
| I6I08_RS01975 | 464027..464164 | - | 138 | Protein_388 | Fe(3+) dicitrate ABC transporter ATP-binding protein FecE | - |
| I6I08_RS01980 | 464761..465399 | + | 639 | WP_141406809.1 | hypothetical protein | - |
| I6I08_RS01985 | 465621..466223 | + | 603 | WP_141406810.1 | zinc transporter | - |
| I6I08_RS01990 | 466715..468037 | - | 1323 | WP_075375252.1 | molybdopterin-synthase adenylyltransferase MoeB | - |
| I6I08_RS01995 | 468079..470217 | - | 2139 | WP_141406682.1 | ABC transporter permease | - |
| I6I08_RS02000 | 470260..471231 | - | 972 | WP_141406683.1 | molybdate ABC transporter substrate-binding protein | - |
| I6I08_RS02005 | 471263..472051 | - | 789 | WP_075254575.1 | respiratory nitrate reductase subunit gamma | - |
| I6I08_RS02010 | 472048..472815 | - | 768 | WP_141406684.1 | nitrate reductase molybdenum cofactor assembly chaperone | - |
| I6I08_RS02015 | 472817..474496 | - | 1680 | WP_141406685.1 | nitrate reductase subunit beta | - |
| I6I08_RS02020 | 474496..478272 | - | 3777 | WP_141406686.1 | nitrate reductase subunit alpha | - |
| I6I08_RS02025 | 478476..479804 | - | 1329 | WP_075371228.1 | NarK/NasA family nitrate transporter | - |
| I6I08_RS02030 | 480124..480657 | + | 534 | WP_141406687.1 | MogA/MoaB family molybdenum cofactor biosynthesis protein | - |
| I6I08_RS02035 | 480701..481351 | - | 651 | WP_141406811.1 | NTP transferase domain-containing protein | - |
| I6I08_RS02040 | 481371..481883 | - | 513 | WP_075414628.1 | cyclic pyranopterin monophosphate synthase MoaC | - |
| I6I08_RS02045 | 481964..483301 | - | 1338 | WP_141406688.1 | molybdopterin molybdotransferase MoeA | - |
| I6I08_RS02050 | 483533..483946 | + | 414 | WP_070511907.1 | molybdenum cofactor biosynthesis protein MoaE | - |
| I6I08_RS02055 | 484010..484318 | - | 309 | WP_020991718.1 | MoaD/ThiS family protein | - |
| I6I08_RS02060 | 484341..485531 | - | 1191 | WP_141406689.1 | GTP 3',8-cyclase MoaA | - |
| I6I08_RS02065 | 485659..485955 | - | 297 | WP_003785642.1 | DUF2249 domain-containing protein | - |
| I6I08_RS02070 | 486185..487366 | + | 1182 | WP_141406690.1 | hypothetical protein | - |
| I6I08_RS02075 | 487363..488766 | + | 1404 | WP_141406691.1 | hypothetical protein | - |
| I6I08_RS02080 | 488763..490460 | + | 1698 | WP_141406692.1 | multicopper oxidase domain-containing protein | - |
| I6I08_RS02085 | 490589..491320 | - | 732 | WP_141406693.1 | helix-turn-helix domain-containing protein | - |
| I6I08_RS02090 | 491582..492700 | - | 1119 | WP_141406694.1 | ribosome small subunit-dependent GTPase A | - |
| I6I08_RS02095 | 492700..494124 | - | 1425 | WP_141406695.1 | 3-phosphoshikimate 1-carboxyvinyltransferase | - |
| I6I08_RS02100 | 494517..495827 | + | 1311 | WP_141406696.1 | hypothetical protein | - |
| I6I08_RS02105 | 496147..498423 | - | 2277 | WP_141406697.1 | NADP-dependent isocitrate dehydrogenase | - |
| I6I08_RS02110 | 498646..499146 | - | 501 | WP_141406698.1 | DoxX family membrane protein | - |
| I6I08_RS02115 | 499539..500159 | + | 621 | WP_198498163.1 | sigma-70 family RNA polymerase sigma factor | - |
| I6I08_RS02120 | 500156..500593 | + | 438 | WP_141406699.1 | mycothiol system anti-sigma-R factor | - |
| I6I08_RS02125 | 501120..501851 | + | 732 | WP_141406700.1 | hypothetical protein | - |
| I6I08_RS02130 | 501879..502472 | - | 594 | WP_075254558.1 | lysophospholipase | - |
| I6I08_RS02135 | 502603..506430 | - | 3828 | WP_141406701.1 | multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit | - |
| I6I08_RS02140 | 507055..509142 | - | 2088 | WP_141406702.1 | hypothetical protein | - |
| I6I08_RS02145 | 509403..510746 | + | 1344 | WP_141406703.1 | hemolysin family protein | - |
| I6I08_RS02150 | 510743..511822 | + | 1080 | WP_141406704.1 | hemolysin family protein | - |
| I6I08_RS02155 | 512136..514361 | + | 2226 | WP_141406705.1 | peptidoglycan DD-metalloendopeptidase family protein | - |
| I6I08_RS02160 | 514374..515129 | + | 756 | WP_101558586.1 | glycerophosphodiester phosphodiesterase | - |
| I6I08_RS02170 | 515469..517154 | + | 1686 | WP_141406706.1 | arginine--tRNA ligase | - |
| I6I08_RS02175 | 517161..518621 | + | 1461 | WP_141406707.1 | diaminopimelate decarboxylase | - |
| I6I08_RS02180 | 519107..520930 | + | 1824 | WP_141406708.1 | LPXTG cell wall anchor domain-containing protein | - |
| I6I08_RS02185 | 521183..521350 | + | 168 | WP_003786832.1 | hypothetical protein | - |
| I6I08_RS02190 | 521620..522948 | + | 1329 | WP_141406709.1 | homoserine dehydrogenase | - |
| I6I08_RS02195 | 522950..523852 | + | 903 | WP_141406710.1 | homoserine kinase | - |
| I6I08_RS02200 | 524749..525897 | + | 1149 | WP_141406711.1 | LLM class flavin-dependent oxidoreductase | - |
| I6I08_RS02205 | 525899..526684 | + | 786 | WP_141406712.1 | NAD(P)H-dependent oxidoreductase | - |
| I6I08_RS02210 | 527061..529145 | + | 2085 | WP_141406713.1 | transcription termination factor Rho | - |
| I6I08_RS02215 | 529287..529499 | + | 213 | WP_003782958.1 | 50S ribosomal protein L31 | - |
| I6I08_RS02220 | 529619..530713 | + | 1095 | WP_009407171.1 | peptide chain release factor 1 | - |
| I6I08_RS02225 | 530703..531599 | + | 897 | WP_075378619.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| I6I08_RS02230 | 531828..532220 | + | 393 | WP_141406714.1 | VOC family protein | - |
| I6I08_RS02235 | 532157..532555 | - | 399 | Protein_439 | helix-turn-helix transcriptional regulator | - |
| I6I08_RS02240 | 532690..533106 | - | 417 | WP_141406715.1 | MarR family transcriptional regulator | - |
| I6I08_RS02245 | 533190..534185 | - | 996 | WP_141406716.1 | NADP-dependent oxidoreductase | - |
| I6I08_RS02250 | 534546..535019 | - | 474 | WP_141406717.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| I6I08_RS02255 | 535000..535635 | - | 636 | WP_141406718.1 | DJ-1/PfpI family protein | - |
| I6I08_RS02260 | 535768..538677 | + | 2910 | WP_141406719.1 | UvrD-helicase domain-containing protein | - |
| I6I08_RS02265 | 538793..539788 | + | 996 | WP_141406720.1 | CPBP family intramembrane metalloprotease | - |
| I6I08_RS02270 | 539936..540655 | - | 720 | WP_141406721.1 | nitroreductase | - |
| I6I08_RS02275 | 540652..541317 | - | 666 | WP_141406722.1 | sugar O-acetyltransferase | - |
| I6I08_RS02280 | 541397..543931 | - | 2535 | WP_141406723.1 | alpha-glucosidase | - |
| I6I08_RS02285 | 544163..546031 | + | 1869 | WP_141406724.1 | alpha-glucosidase | - |
| I6I08_RS02290 | 546144..546791 | + | 648 | WP_141406725.1 | nitroreductase | - |
| I6I08_RS02295 | 546781..547647 | - | 867 | WP_141406726.1 | CPBP family intramembrane metalloprotease | - |
| I6I08_RS02300 | 548031..548510 | + | 480 | WP_141406727.1 | hypothetical protein | - |
| I6I08_RS02305 | 548523..549824 | - | 1302 | WP_141406728.1 | chloride channel protein | - |
| I6I08_RS02310 | 549868..552243 | - | 2376 | WP_176746993.1 | 6-phosphofructokinase | - |
| I6I08_RS02315 | 552477..552617 | - | 141 | WP_170198613.1 | hypothetical protein | - |
| I6I08_RS02320 | 553245..554450 | + | 1206 | WP_009407046.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| I6I08_RS02325 | 554454..555395 | + | 942 | WP_009747943.1 | succinate--CoA ligase subunit alpha | - |
| I6I08_RS02330 | 555392..556669 | + | 1278 | WP_141406729.1 | hypothetical protein | - |
| I6I08_RS02335 | 556679..559174 | - | 2496 | WP_141406730.1 | hypothetical protein | - |
| I6I08_RS02340 | 559267..559419 | - | 153 | WP_170198614.1 | hypothetical protein | - |
| I6I08_RS02345 | 559437..561239 | + | 1803 | WP_141406731.1 | bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase | - |
| I6I08_RS02350 | 561359..561658 | + | 300 | WP_009747903.1 | DUF3017 domain-containing protein | - |
| I6I08_RS02355 | 561841..563193 | + | 1353 | WP_141406732.1 | dicarboxylate/amino acid:cation symporter | - |
| I6I08_RS02360 | 563326..565182 | - | 1857 | WP_141406733.1 | ABC transporter ATP-binding protein/permease | - |
| I6I08_RS02365 | 565179..566990 | - | 1812 | WP_141406734.1 | ABC transporter ATP-binding protein/permease | - |
| I6I08_RS02370 | 567245..568231 | + | 987 | WP_075373778.1 | malate dehydrogenase | - |
| I6I08_RS02375 | 568618..569937 | + | 1320 | WP_009407007.1 | extracellular solute-binding protein | - |
| I6I08_RS02380 | 570081..571010 | + | 930 | WP_009747956.1 | sugar ABC transporter permease | - |
| I6I08_RS02385 | 571017..571871 | + | 855 | WP_009747887.1 | carbohydrate ABC transporter permease | - |
| I6I08_RS02390 | 572039..572275 | + | 237 | WP_175284726.1 | hypothetical protein | - |
| I6I08_RS02395 | 572311..572802 | - | 492 | WP_141406735.1 | hypothetical protein | - |
| I6I08_RS02400 | 572812..574434 | - | 1623 | WP_075377976.1 | DivIVA domain-containing protein | - |
| I6I08_RS02405 | 574903..576672 | + | 1770 | WP_075377975.1 | hypothetical protein | - |
| I6I08_RS02410 | 576669..577718 | + | 1050 | WP_141406736.1 | Tat pathway signal protein | - |
| I6I08_RS02415 | 577886..578836 | + | 951 | WP_141406737.1 | tetratricopeptide repeat protein | - |
| I6I08_RS02420 | 578938..581304 | - | 2367 | WP_141406738.1 | glycogen/starch/alpha-glucan phosphorylase | - |
| I6I08_RS02425 | 583219..585429 | - | 2211 | WP_141406739.1 | 1,4-alpha-glucan branching protein GlgB | - |
| I6I08_RS02430 | 585518..587149 | - | 1632 | WP_141406740.1 | phosphotransferase | - |
| I6I08_RS02435 | 587277..589138 | - | 1862 | Protein_479 | maltose alpha-D-glucosyltransferase | - |
| I6I08_RS02440 | 589150..591147 | - | 1998 | WP_198498164.1 | alpha-1,4-glucan--maltose-1-phosphate maltosyltransferase | - |
| I6I08_RS02445 | 591441..592553 | - | 1113 | WP_141406742.1 | tryptophan--tRNA ligase | - |
| I6I08_RS02450 | 592617..594344 | - | 1728 | WP_141406743.1 | alpha/beta-hydrolase family protein | - |
| I6I08_RS02455 | 594388..596805 | - | 2418 | WP_141406744.1 | glycogen debranching protein GlgX | - |
| I6I08_RS02460 | 597009..597767 | + | 759 | WP_043538137.1 | electron transfer flavoprotein subunit beta | - |
| I6I08_RS02465 | 597865..598845 | + | 981 | WP_075377970.1 | electron transfer flavoprotein subunit alpha/FixB family protein | - |
| I6I08_RS02470 | 598932..601244 | - | 2313 | WP_141406745.1 | hypothetical protein | - |
| I6I08_RS02475 | 601387..602574 | - | 1188 | WP_141406746.1 | tRNA 2-thiouridine(34) synthase MnmA | - |
| I6I08_RS02480 | 602985..603281 | + | 297 | WP_141406747.1 | hypothetical protein | - |
| I6I08_RS02485 | 603476..603841 | - | 366 | WP_141406748.1 | hypothetical protein | - |
| I6I08_RS02490 | 603877..605109 | - | 1233 | WP_141406749.1 | cysteine desulfurase | - |
| I6I08_RS02495 | 605301..606413 | + | 1113 | WP_141406750.1 | NAD(+) diphosphatase | - |
| I6I08_RS02500 | 606477..608564 | + | 2088 | WP_141406751.1 | ATP-dependent DNA helicase UvrD2 | - |
| I6I08_RS02505 | 608595..609575 | - | 981 | WP_141406752.1 | hypothetical protein | - |
| I6I08_RS02510 | 609744..610991 | - | 1248 | WP_198498138.1 | peptidase S16 | - |
| I6I08_RS02515 | 611264..612826 | + | 1563 | WP_141406754.1 | zinc-dependent metalloprotease | - |
| I6I08_RS02520 | 612887..613468 | - | 582 | WP_141406812.1 | hypothetical protein | - |
| I6I08_RS02525 | 613702..616908 | + | 3207 | WP_141406755.1 | UPF0182 family protein | - |
| I6I08_RS02535 | 617232..618071 | + | 840 | WP_141406756.1 | polyphosphate kinase 2 | - |
| I6I08_RS02540 | 618068..618823 | - | 756 | WP_141406757.1 | NAD-dependent protein deacylase | - |
| I6I08_RS02545 | 618961..619176 | - | 216 | WP_009407243.1 | DUF3107 domain-containing protein | - |
| I6I08_RS02550 | 619421..623056 | + | 3636 | WP_141406758.1 | ATP-dependent helicase | - |
| I6I08_RS02555 | 623053..626472 | + | 3420 | WP_141406759.1 | DEAD/DEAH box helicase | - |
| I6I08_RS02560 | 626512..627828 | - | 1317 | WP_141406760.1 | phosphotransferase | - |
| I6I08_RS02565 | 628118..629368 | + | 1251 | WP_040321406.1 | CpaF family protein | - |
| I6I08_RS02570 | 629368..630219 | + | 852 | WP_020991685.1 | type II secretion system F family protein | - |
| I6I08_RS02575 | 630216..631169 | + | 954 | WP_003786671.1 | type II secretion system F family protein | - |
| I6I08_RS02580 | 631263..631493 | + | 231 | WP_003786669.1 | hypothetical protein | - |
| I6I08_RS02585 | 631483..631956 | + | 474 | WP_101558526.1 | pilus assembly protein | - |
| I6I08_RS02590 | 632113..632526 | + | 414 | WP_040321405.1 | hypothetical protein | - |
| I6I08_RS02595 | 632523..633029 | + | 507 | WP_141406761.1 | glycosyltransferase | - |
| I6I08_RS02600 | 633097..633495 | - | 399 | WP_141406762.1 | hypothetical protein | - |
| I6I08_RS02605 | 633526..634437 | + | 912 | WP_141406763.1 | LysR family transcriptional regulator | - |
| I6I08_RS02610 | 634539..635660 | + | 1122 | WP_010613489.1 | peptide chain release factor 2 | - |
| I6I08_RS02615 | 635943..636743 | + | 801 | WP_170198619.1 | CPBP family intramembrane metalloprotease | - |
| I6I08_RS02620 | 636682..637233 | - | 552 | WP_141406813.1 | methylated-DNA--[protein]-cysteine S-methyltransferase | - |
| I6I08_RS02625 | 637460..639142 | + | 1683 | WP_141406765.1 | energy-dependent translational throttle protein EttA | - |
| I6I08_RS02630 | 639321..639971 | + | 651 | WP_141406766.1 | hypothetical protein | - |
| I6I08_RS02635 | 640082..640786 | + | 705 | WP_141406767.1 | M23 family metallopeptidase | - |
| I6I08_RS02640 | 641093..641797 | - | 705 | Protein_519 | alpha/beta hydrolase | - |
| I6I08_RS02645 | 641872..642171 | - | 300 | WP_101586256.1 | hypothetical protein | - |
| I6I08_RS02650 | 642264..643244 | - | 981 | WP_141406768.1 | thioesterase family protein | - |
| I6I08_RS02655 | 643241..644938 | - | 1698 | WP_070511054.1 | phosphoenolpyruvate--protein phosphotransferase | - |
| I6I08_RS02660 | 645307..645534 | + | 228 | WP_009407368.1 | PTS glucose/sucrose transporter subunit IIB | - |
| I6I08_RS02665 | 645968..648184 | + | 2217 | WP_070511058.1 | 4-alpha-glucanotransferase | - |
| I6I08_RS02670 | 648333..648794 | - | 462 | WP_070511060.1 | PTS glucose transporter subunit IIA | - |
| I6I08_RS02675 | 648791..649021 | - | 231 | WP_070511062.1 | PTS glucose/sucrose transporter subunit IIB | - |
| I6I08_RS02680 | 649209..649958 | - | 750 | WP_003786636.1 | GntR family transcriptional regulator | - |
| I6I08_RS02685 | 650219..651667 | + | 1449 | WP_003786634.1 | PTS transporter subunit EIIC | - |
| I6I08_RS02690 | 651799..654399 | - | 2601 | WP_141406769.1 | aminopeptidase N | - |
| I6I08_RS02695 | 654592..656322 | - | 1731 | WP_198498139.1 | peptidase | - |
| I6I08_RS02700 | 656548..657651 | - | 1104 | WP_141406770.1 | LCP family protein | - |
| I6I08_RS02705 | 657808..658773 | - | 966 | WP_141406771.1 | LPXTG cell wall anchor domain-containing protein | - |
| I6I08_RS02710 | 658977..661055 | - | 2079 | WP_198498165.1 | peptidase M13 | - |
| I6I08_RS02715 | 661256..661756 | + | 501 | WP_141406773.1 | ribose-5-phosphate isomerase | - |
| I6I08_RS02720 | 661759..662760 | + | 1002 | WP_141406774.1 | Fpg/Nei family DNA glycosylase | - |
| I6I08_RS02725 | 662801..664099 | + | 1299 | WP_141406775.1 | alpha/beta fold hydrolase | - |
| I6I08_RS02730 | 664217..664792 | - | 576 | WP_141406776.1 | serine O-acetyltransferase | - |
| I6I08_RS02735 | 664918..665847 | - | 930 | WP_101559676.1 | cysteine synthase A | - |
| I6I08_RS02740 | 666388..667176 | - | 789 | WP_141406777.1 | YigZ family protein | - |
| I6I08_RS02745 | 667333..667497 | + | 165 | WP_003784449.1 | 50S ribosomal protein L32 | - |
| I6I08_RS02760 | 668006..669349 | + | 1344 | WP_010613512.1 | trigger factor | - |
| I6I08_RS02765 | 669527..670660 | - | 1134 | WP_003786607.1 | hypothetical protein | - |
| I6I08_RS02770 | 671235..671603 | - | 369 | WP_009747840.1 | cupin domain-containing protein | - |
| I6I08_RS02775 | 671987..672559 | + | 573 | WP_050998538.1 | ATP-dependent Clp protease proteolytic subunit | - |
| I6I08_RS02780 | 672561..673235 | + | 675 | WP_003786600.1 | ATP-dependent Clp protease proteolytic subunit | - |
| I6I08_RS02785 | 673468..674790 | + | 1323 | WP_020991680.1 | ATP-dependent Clp protease ATP-binding subunit ClpX | - |
| I6I08_RS02790 | 674787..675119 | + | 333 | WP_070513832.1 | chorismate mutase | - |
| I6I08_RS02795 | 675248..677149 | - | 1902 | WP_141406778.1 | long-chain fatty acid--CoA ligase | - |
| I6I08_RS02800 | 677197..679089 | - | 1893 | WP_141406779.1 | AMP-dependent synthetase/ligase | - |
| I6I08_RS02805 | 679402..680694 | + | 1293 | WP_141406780.1 | ABC transporter substrate-binding protein | - |
| I6I08_RS02810 | 680776..681813 | + | 1038 | WP_009747866.1 | sugar ABC transporter permease | - |
| I6I08_RS02815 | 681810..682673 | + | 864 | WP_075418664.1 | carbohydrate ABC transporter permease | - |
| I6I08_RS02820 | 682878..684656 | + | 1779 | WP_141406781.1 | glycoside hydrolase family 13 protein | - |
| I6I08_RS02825 | 684637..685650 | + | 1014 | WP_141406782.1 | LacI family transcriptional regulator | - |
| I6I08_RS02830 | 685729..686649 | + | 921 | WP_141406783.1 | hypothetical protein | - |
| I6I08_RS02835 | 686718..689534 | - | 2817 | WP_141406784.1 | valine--tRNA ligase | - |
| I6I08_RS02840 | 689726..691375 | + | 1650 | WP_141406785.1 | proteasome ATPase | - |
| I6I08_RS02845 | 691429..693156 | + | 1728 | WP_141406814.1 | proteasome accessory factor PafA2 family protein | - |
| I6I08_RS02850 | 693153..693341 | + | 189 | WP_070513814.1 | ubiquitin-like protein Pup | - |
| I6I08_RS02855 | 693338..694882 | + | 1545 | WP_141406786.1 | proteasome accessory factor PafA2 family protein | - |
| I6I08_RS02860 | 695287..695922 | + | 636 | WP_141406787.1 | ECF transporter S component | - |
| I6I08_RS02865 | 695993..698401 | + | 2409 | WP_141406815.1 | ATP-binding cassette domain-containing protein | - |
| I6I08_RS02870 | 698412..700259 | + | 1848 | WP_141406788.1 | ABC transporter ATP-binding protein/permease | - |
| I6I08_RS02875 | 700262..702001 | + | 1740 | WP_141406789.1 | ABC transporter ATP-binding protein/permease | - |
| I6I08_RS02880 | 702216..703169 | + | 954 | WP_141406790.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS02885 | 703287..704096 | + | 810 | WP_141406791.1 | ABC transporter permease | - |
| I6I08_RS02890 | 704202..705005 | + | 804 | WP_141406792.1 | TetR/AcrR family transcriptional regulator | - |
| I6I08_RS02895 | 705105..705791 | - | 687 | WP_141406793.1 | sirohydrochlorin chelatase | - |
| I6I08_RS02900 | 705788..706831 | - | 1044 | WP_141406794.1 | sulfite exporter TauE/SafE family protein | - |
| I6I08_RS02905 | 706874..707674 | - | 801 | WP_141406795.1 | uroporphyrinogen-III C-methyltransferase | - |
| I6I08_RS02910 | 707678..709036 | - | 1359 | WP_141406796.1 | 50S ribosome-binding GTPase | - |
| I6I08_RS02915 | 709036..710046 | - | 1011 | WP_141406797.1 | sulfate adenylyltransferase subunit CysD | - |
| I6I08_RS02920 | 710043..710834 | - | 792 | WP_141406798.1 | phosphoadenylyl-sulfate reductase | - |
| I6I08_RS02925 | 710831..712534 | - | 1704 | WP_141406799.1 | nitrite/sulfite reductase | - |
| I6I08_RS02930 | 713002..713826 | - | 825 | WP_009406966.1 | pyrroline-5-carboxylate reductase | - |
| I6I08_RS02935 | 713916..715283 | - | 1368 | WP_141406800.1 | sodium:proton antiporter | - |
| I6I08_RS02940 | 715401..716192 | + | 792 | WP_141406801.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| I6I08_RS02945 | 716323..717189 | + | 867 | WP_141406802.1 | hypothetical protein | - |
| I6I08_RS02950 | 717347..718294 | + | 948 | WP_141406803.1 | aldo/keto reductase | - |
| I6I08_RS02955 | 718860..722231 | + | 3372 | WP_141406804.1 | isoleucine--tRNA ligase | - |
| I6I08_RS02960 | 722465..723406 | + | 942 | WP_141406816.1 | glycosyl transferase | - |
| I6I08_RS02965 | 723652..724995 | + | 1344 | WP_141406805.1 | polysaccharide biosynthesis tyrosine autokinase | - |
| I6I08_RS02970 | 725857..727740 | + | 1884 | WP_141406817.1 | polysaccharide biosynthesis protein | - |
| I6I08_RS02975 | 727740..728951 | + | 1212 | WP_141406806.1 | DegT/DnrJ/EryC1/StrS family aminotransferase | - |
| I6I08_RS02980 | 728948..729634 | + | 687 | WP_075378398.1 | sugar transferase | - |
| I6I08_RS02985 | 729666..730448 | + | 783 | WP_075378397.1 | glycosyltransferase | - |
| I6I08_RS02990 | 730514..731665 | + | 1152 | WP_075378396.1 | glycosyltransferase | - |
| I6I08_RS02995 | 731675..732781 | + | 1107 | WP_141406807.1 | EpsG family protein | - |
| I6I08_RS03000 | 732781..733209 | + | 429 | WP_075378394.1 | serine acetyltransferase | - |
| I6I08_RS03005 | 733297..734736 | + | 1440 | WP_075378393.1 | lipopolysaccharide biosynthesis protein | - |
| I6I08_RS03010 | 734983..735969 | + | 987 | WP_141407498.1 | polysaccharide pyruvyl transferase family protein | - |
| I6I08_RS03015 | 735953..737380 | + | 1428 | WP_198498140.1 | lipopolysaccharide biosynthesis protein | - |
| I6I08_RS03020 | 737404..738726 | - | 1323 | WP_141406353.1 | UDP-glucose/GDP-mannose dehydrogenase family protein | - |
| I6I08_RS03025 | 739088..740890 | + | 1803 | WP_075378389.1 | bifunctional folylpolyglutamate synthase/dihydrofolate synthase | - |
| I6I08_RS03030 | 741209..741889 | + | 681 | WP_141406352.1 | dihydroxyacetone kinase subunit L | - |
| I6I08_RS03035 | 741977..742417 | + | 441 | WP_075378387.1 | nucleoside-diphosphate kinase | - |
| I6I08_RS03040 | 742538..743782 | - | 1245 | WP_075378386.1 | ABC transporter permease | - |
| I6I08_RS03045 | 743782..744729 | - | 948 | WP_141406351.1 | ATP-binding cassette domain-containing protein | - |
| I6I08_RS03050 | 744900..748679 | + | 3780 | WP_141406350.1 | chromosome segregation protein SMC | - |
| I6I08_RS03055 | 748841..749215 | + | 375 | WP_010613567.1 | hypothetical protein | - |
| I6I08_RS03060 | 749576..750736 | + | 1161 | WP_075378383.1 | signal recognition particle-docking protein FtsY | - |
| I6I08_RS03065 | 750865..751476 | - | 612 | WP_009407399.1 | response regulator transcription factor | - |
| I6I08_RS03070 | 751554..752711 | - | 1158 | WP_141406349.1 | sensor histidine kinase | - |
| I6I08_RS03075 | 752734..753462 | - | 729 | WP_178389472.1 | ABC transporter permease | - |
| I6I08_RS03080 | 753618..754610 | - | 993 | WP_075378380.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS03085 | 754974..756659 | + | 1686 | WP_075378379.1 | signal recognition particle protein | - |
| I6I08_RS03090 | 756685..757296 | - | 612 | WP_075378378.1 | response regulator transcription factor | - |
| I6I08_RS03095 | 757293..758387 | - | 1095 | WP_141406365.1 | two-component sensor histidine kinase | - |
| I6I08_RS03100 | 758522..759406 | - | 885 | WP_075378376.1 | hypothetical protein | - |
| I6I08_RS03105 | 759465..760484 | - | 1020 | WP_075378375.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS03110 | 760591..761160 | - | 570 | WP_141406364.1 | hypothetical protein | - |
| I6I08_RS03115 | 762466..762948 | + | 483 | WP_070512919.1 | 30S ribosomal protein S16 | - |
| I6I08_RS03120 | 762950..763186 | + | 237 | WP_003786440.1 | RNA-binding protein | - |
| I6I08_RS03125 | 763493..764038 | + | 546 | WP_141406348.1 | ribosome maturation factor RimM | - |
| I6I08_RS03130 | 764035..765453 | + | 1419 | WP_141406347.1 | tRNA (guanosine(37)-N1)-methyltransferase TrmD | - |
| I6I08_RS03135 | 765450..766358 | + | 909 | WP_141406346.1 | signal peptidase I | - |
| I6I08_RS03140 | 766602..766949 | + | 348 | WP_003786428.1 | 50S ribosomal protein L19 | - |
| I6I08_RS03145 | 767061..768281 | + | 1221 | WP_141406345.1 | signal peptidase I | - |
| I6I08_RS03150 | 768278..769012 | + | 735 | WP_141406344.1 | ribonuclease HII | - |
| I6I08_RS03155 | 769108..769416 | + | 309 | WP_003781502.1 | DUF2469 domain-containing protein | - |
| I6I08_RS03160 | 769579..770139 | + | 561 | WP_075378443.1 | YraN family protein | - |
| I6I08_RS03165 | 770130..771701 | + | 1572 | WP_075378368.1 | YifB family Mg chelatase-like AAA ATPase | - |
| I6I08_RS03170 | 771716..773077 | + | 1362 | WP_081379337.1 | DNA-protecting protein DprA | - |
| I6I08_RS03175 | 773214..774482 | - | 1269 | WP_141406343.1 | serine/threonine protein kinase | - |
| I6I08_RS03180 | 774479..776107 | - | 1629 | WP_141406342.1 | FHA domain-containing protein | - |
| I6I08_RS03185 | 776104..776469 | - | 366 | WP_003786411.1 | hypothetical protein | - |
| I6I08_RS03190 | 776925..777848 | + | 924 | WP_141406341.1 | tyrosine recombinase XerC | - |
| I6I08_RS03195 | 777874..778248 | - | 375 | WP_040321372.1 | M23 family metallopeptidase | - |
| I6I08_RS03200 | 779185..780042 | + | 858 | WP_003786406.1 | 30S ribosomal protein S2 | - |
| I6I08_RS03205 | 780158..780997 | + | 840 | WP_003786404.1 | elongation factor Ts | - |
| I6I08_RS03210 | 781269..782021 | + | 753 | WP_003786403.1 | UMP kinase | - |
| I6I08_RS03215 | 782177..782734 | + | 558 | WP_003786400.1 | ribosome recycling factor | - |
| I6I08_RS03220 | 782807..783736 | + | 930 | WP_009407305.1 | phosphatidate cytidylyltransferase | - |
| I6I08_RS03225 | 783808..785070 | + | 1263 | WP_141406340.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| I6I08_RS03230 | 785067..785612 | + | 546 | WP_003786395.1 | DivIVA domain-containing protein | - |
| I6I08_RS03235 | 785654..786946 | + | 1293 | WP_141406339.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
| I6I08_RS03240 | 786943..788277 | + | 1335 | WP_141406338.1 | site-2 protease family protein | - |
| I6I08_RS03245 | 788380..789561 | + | 1182 | WP_003786387.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
| I6I08_RS03250 | 789611..790600 | + | 990 | WP_141406337.1 | GNAT family N-acetyltransferase | - |
| I6I08_RS03255 | 790711..791001 | + | 291 | WP_141406336.1 | hypothetical protein | - |
| I6I08_RS03260 | 790998..792374 | + | 1377 | WP_070511125.1 | tripartite tricarboxylate transporter permease | - |
| I6I08_RS03265 | 792544..793632 | - | 1089 | WP_141406335.1 | type 2 isopentenyl-diphosphate Delta-isomerase | - |
| I6I08_RS03270 | 793629..794816 | - | 1188 | WP_141406334.1 | phosphomevalonate kinase | - |
| I6I08_RS03275 | 794807..795835 | - | 1029 | WP_141406333.1 | diphosphomevalonate decarboxylase | - |
| I6I08_RS03280 | 795832..796794 | - | 963 | WP_141406332.1 | mevalonate kinase | - |
| I6I08_RS03285 | 797053..798885 | + | 1833 | WP_075378351.1 | proline--tRNA ligase | - |
| I6I08_RS03290 | 798899..801925 | - | 3027 | WP_141406331.1 | DEAD/DEAH box helicase family protein | - |
| I6I08_RS03295 | 801929..802165 | - | 237 | WP_141406330.1 | hypothetical protein | - |
| I6I08_RS03300 | 802167..803216 | - | 1050 | WP_141406329.1 | Tat pathway signal protein | - |
| I6I08_RS03305 | 803341..803859 | + | 519 | WP_075378347.1 | ribosome maturation factor RimP | - |
| I6I08_RS03310 | 804053..805093 | + | 1041 | WP_141406328.1 | transcription termination/antitermination protein NusA | - |
| I6I08_RS03315 | 805212..805544 | + | 333 | WP_141406327.1 | YlxR family protein | - |
| I6I08_RS03320 | 805636..808632 | + | 2997 | WP_141406326.1 | translation initiation factor IF-2 | - |
| I6I08_RS03325 | 808752..810323 | - | 1572 | WP_141406325.1 | molybdopterin-dependent oxidoreductase | - |
| I6I08_RS03330 | 810688..813030 | + | 2343 | WP_141406324.1 | cbb3-type cytochrome c oxidase subunit I | - |
| I6I08_RS03335 | 813030..813959 | + | 930 | WP_075374511.1 | hypothetical protein | - |
| I6I08_RS03340 | 814010..814834 | + | 825 | WP_141406323.1 | slipin family protein | - |
| I6I08_RS03345 | 814785..815777 | - | 993 | WP_141406322.1 | EamA family transporter RarD | - |
| I6I08_RS03350 | 815975..816472 | + | 498 | WP_075378340.1 | 30S ribosome-binding factor RbfA | - |
| I6I08_RS03355 | 816469..817563 | + | 1095 | WP_075378339.1 | tRNA pseudouridine(55) synthase TruB | - |
| I6I08_RS03360 | 817635..817931 | + | 297 | WP_075378338.1 | hypothetical protein | - |
| I6I08_RS03365 | 817942..818763 | - | 822 | WP_141406321.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS03370 | 818775..821105 | - | 2331 | WP_141406320.1 | FtsX-like permease family protein | - |
| I6I08_RS03375 | 821408..822433 | + | 1026 | WP_141406363.1 | bifunctional riboflavin kinase/FAD synthetase | - |
| I6I08_RS03380 | 822654..822923 | + | 270 | WP_003786006.1 | 30S ribosomal protein S15 | - |
| I6I08_RS03385 | 823009..824160 | - | 1152 | WP_141406319.1 | lactaldehyde reductase | - |
| I6I08_RS03390 | 824589..826946 | + | 2358 | WP_141406318.1 | polyribonucleotide nucleotidyltransferase | - |
| I6I08_RS03395 | 827131..828537 | + | 1407 | WP_141406362.1 | insulinase family protein | - |
| I6I08_RS03400 | 828790..829722 | - | 933 | WP_141406361.1 | oxidoreductase | - |
| I6I08_RS03405 | 829891..830643 | + | 753 | WP_141406317.1 | 4-hydroxy-tetrahydrodipicolinate reductase | - |
| I6I08_RS03410 | 830673..831449 | - | 777 | WP_141406316.1 | GNAT family N-acetyltransferase | - |
| I6I08_RS03415 | 831571..832467 | + | 897 | WP_141406315.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| I6I08_RS03420 | 832490..832936 | + | 447 | WP_141406314.1 | pyrimidine dimer DNA glycosylase/endonuclease V | - |
| I6I08_RS03425 | 832976..834760 | - | 1785 | WP_141406313.1 | AMP-binding protein | - |
| I6I08_RS03430 | 834836..836752 | - | 1917 | WP_075378328.1 | AMP-binding protein | - |
| I6I08_RS03435 | 836913..839528 | - | 2616 | WP_075378327.1 | AAA family ATPase | - |
| I6I08_RS03440 | 840023..840961 | + | 939 | WP_009747573.1 | PAC2 family protein | - |
| I6I08_RS03445 | 841022..841798 | - | 777 | WP_075378439.1 | fused MFS/spermidine synthase | - |
| I6I08_RS03450 | 841946..843217 | + | 1272 | WP_075378326.1 | DNA polymerase IV | - |
| I6I08_RS03455 | 843342..843752 | + | 411 | WP_075378325.1 | DUF3040 domain-containing protein | - |
| I6I08_RS03460 | 844393..844824 | + | 432 | WP_003786301.1 | division/cell wall cluster transcriptional repressor MraZ | - |
| I6I08_RS03465 | 845091..846218 | + | 1128 | WP_075378324.1 | 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH | - |
| I6I08_RS03470 | 846326..846790 | + | 465 | WP_141406312.1 | hypothetical protein | - |
| I6I08_RS03475 | 846797..848596 | + | 1800 | WP_141406311.1 | penicillin-binding protein 2 | - |
| I6I08_RS03480 | 848703..850289 | + | 1587 | WP_141406310.1 | UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase | - |
| I6I08_RS03485 | 850274..851725 | + | 1452 | WP_141406309.1 | UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase | - |
| I6I08_RS03490 | 851722..852822 | + | 1101 | WP_003786289.1 | phospho-N-acetylmuramoyl-pentapeptide- transferase | - |
| I6I08_RS03495 | 852925..854484 | + | 1560 | WP_198498141.1 | UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase | - |
| I6I08_RS03500 | 854481..856010 | + | 1530 | WP_141406308.1 | putative lipid II flippase FtsW | - |
| I6I08_RS03505 | 855994..857253 | + | 1260 | WP_075378318.1 | undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase | - |
| I6I08_RS03510 | 857250..858824 | + | 1575 | WP_141406307.1 | UDP-N-acetylmuramate--L-alanine ligase | - |
| I6I08_RS03515 | 859231..860058 | + | 828 | WP_101559570.1 | FtsQ-type POTRA domain-containing protein | - |
| I6I08_RS03520 | 860326..861699 | + | 1374 | WP_178388634.1 | cell division protein FtsZ | - |
| I6I08_RS03525 | 861729..862544 | + | 816 | WP_141406306.1 | polyphenol oxidase family protein | - |
| I6I08_RS03530 | 862696..863160 | + | 465 | WP_003779869.1 | cell division protein SepF | - |
| I6I08_RS03535 | 863173..863469 | + | 297 | WP_003786269.1 | YggT family protein | - |
| I6I08_RS03540 | 863635..864243 | + | 609 | WP_003786267.1 | DivIVA domain-containing protein | - |
| I6I08_RS03545 | 864490..865299 | + | 810 | WP_075378315.1 | signal peptidase II | - |
| I6I08_RS03550 | 865296..866216 | + | 921 | WP_070511262.1 | RluA family pseudouridine synthase | - |
| I6I08_RS03555 | 866274..866876 | + | 603 | WP_141406359.1 | GNAT family N-acetyltransferase | - |
| I6I08_RS03560 | 866942..867910 | + | 969 | WP_075378314.1 | 2-dehydropantoate 2-reductase | - |
| I6I08_RS03565 | 868087..871680 | + | 3594 | WP_075378313.1 | DNA polymerase III subunit alpha | - |
| I6I08_RS03570 | 871989..874013 | + | 2025 | WP_141406305.1 | BCCT family transporter | - |
| I6I08_RS03575 | 874047..874313 | - | 267 | WP_141406304.1 | RNA-binding S4 domain-containing protein | - |
| I6I08_RS03580 | 874500..877013 | + | 2514 | WP_075378311.1 | right-handed parallel beta-helix repeat-containing protein | - |
| I6I08_RS03585 | 877088..877456 | + | 369 | WP_141406303.1 | hypothetical protein | - |
| I6I08_RS03590 | 877610..878818 | + | 1209 | WP_141406302.1 | methylenetetrahydrofolate reductase | - |
| I6I08_RS03595 | 878815..881202 | + | 2388 | WP_081379330.1 | 5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase | - |
| I6I08_RS03600 | 881295..882635 | + | 1341 | WP_075378433.1 | histidinol dehydrogenase | - |
| I6I08_RS03605 | 883004..883264 | + | 261 | WP_075378308.1 | hypothetical protein | - |
| I6I08_RS03610 | 883264..884835 | + | 1572 | WP_141406358.1 | glycosyltransferase | - |
| I6I08_RS03615 | 884832..885545 | + | 714 | WP_009406401.1 | hypothetical protein | - |
| I6I08_RS03620 | 885630..886832 | + | 1203 | WP_075378431.1 | UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing) | - |
| I6I08_RS03625 | 886829..888784 | + | 1956 | WP_075378307.1 | polysaccharide deacetylase family protein | - |
| I6I08_RS03630 | 888879..890372 | + | 1494 | WP_075378306.1 | Tat pathway signal sequence | - |
| I6I08_RS03635 | 890422..892731 | - | 2310 | WP_081379329.1 | DEAD/DEAH box helicase | - |
| I6I08_RS03640 | 893153..894019 | + | 867 | WP_081379334.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| I6I08_RS03645 | 894062..895996 | + | 1935 | WP_141406301.1 | sodium:proton antiporter | - |
| I6I08_RS03650 | 896098..897240 | + | 1143 | WP_141406300.1 | histidinol-phosphate transaminase | - |
| I6I08_RS03655 | 897352..897951 | + | 600 | WP_003786233.1 | imidazoleglycerol-phosphate dehydratase HisB | - |
| I6I08_RS03660 | 897951..898862 | + | 912 | WP_198498142.1 | hypothetical protein | - |
| I6I08_RS03665 | 898909..900492 | - | 1584 | WP_141406357.1 | protein kinase | - |
| I6I08_RS03670 | 900917..901555 | + | 639 | WP_075378302.1 | imidazole glycerol phosphate synthase subunit HisH | - |
| I6I08_RS03675 | 901597..902349 | + | 753 | WP_009406038.1 | bifunctional 1-(5-phosphoribosyl)-5-((5- phosphoribosylamino)methylideneamino)imidazole-4- carboxamide isomerase/phosphoribosylanthranilate isomerase PriA | - |
| I6I08_RS03680 | 902435..903337 | + | 903 | WP_198498143.1 | SseB family protein | - |
| I6I08_RS03685 | 903360..903677 | - | 318 | WP_170198586.1 | hypothetical protein | - |
| I6I08_RS03690 | 903745..904533 | + | 789 | WP_198498144.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS03695 | 904530..906140 | + | 1611 | WP_141406296.1 | hypothetical protein | - |
| I6I08_RS03700 | 906463..907104 | + | 642 | WP_075253374.1 | translation initiation factor IF-3 | - |
| I6I08_RS03705 | 907228..907422 | + | 195 | WP_003780493.1 | 50S ribosomal protein L35 | - |
| I6I08_RS03710 | 907450..907830 | + | 381 | WP_003786223.1 | 50S ribosomal protein L20 | - |
| I6I08_RS03715 | 908193..908519 | - | 327 | WP_141406295.1 | hypothetical protein | - |
| I6I08_RS03720 | 908539..910929 | - | 2391 | WP_141406294.1 | hypothetical protein | - |
| I6I08_RS03725 | 911257..912189 | + | 933 | WP_075374056.1 | RNA methyltransferase | - |
| I6I08_RS03730 | 912191..913471 | - | 1281 | WP_141406293.1 | glycosyl transferase family 28 | - |
| I6I08_RS03735 | 913689..914309 | - | 621 | WP_141406292.1 | TetR/AcrR family transcriptional regulator | - |
| I6I08_RS03740 | 914632..915360 | + | 729 | WP_170198587.1 | amino acid ABC transporter ATP-binding protein | - |
| I6I08_RS03745 | 915450..916430 | + | 981 | WP_075378293.1 | glutamate ABC transporter substrate-binding protein | - |
| I6I08_RS03750 | 916556..917212 | + | 657 | WP_003786217.1 | amino acid ABC transporter permease | - |
| I6I08_RS03755 | 917209..918084 | + | 876 | WP_075378291.1 | amino acid ABC transporter permease | - |
| I6I08_RS03760 | 918131..918526 | - | 396 | WP_141406291.1 | type II toxin-antitoxin system VapC family toxin | - |
| I6I08_RS03765 | 918523..918780 | - | 258 | WP_198498145.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| I6I08_RS03770 | 918942..919400 | - | 459 | WP_141406290.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| I6I08_RS03775 | 919448..919807 | + | 360 | WP_081379328.1 | hypothetical protein | - |
| I6I08_RS03780 | 919848..921518 | - | 1671 | WP_141406289.1 | Tat pathway signal protein | - |
| I6I08_RS03785 | 921518..922423 | - | 906 | WP_198498166.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS03790 | 922531..923394 | - | 864 | WP_141406287.1 | MerR family transcriptional regulator | - |
| I6I08_RS03795 | 923609..924694 | + | 1086 | WP_075378284.1 | phenylalanine--tRNA ligase subunit alpha | - |
| I6I08_RS03800 | 924696..927353 | + | 2658 | WP_141406286.1 | phenylalanine--tRNA ligase subunit beta | - |
| I6I08_RS03805 | 927494..928012 | + | 519 | WP_141406285.1 | flavodoxin | - |
| I6I08_RS03810 | 928116..929225 | + | 1110 | WP_141406284.1 | N-acetyl-gamma-glutamyl-phosphate reductase | - |
| I6I08_RS03815 | 929222..930418 | + | 1197 | WP_075378279.1 | bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ | - |
| I6I08_RS03820 | 930415..931341 | + | 927 | WP_141406283.1 | acetylglutamate kinase | - |
| I6I08_RS03825 | 931338..932612 | + | 1275 | WP_141406282.1 | acetylornithine transaminase | - |
| I6I08_RS03830 | 932609..933196 | + | 588 | WP_010613732.1 | arginine repressor ArgR | - |
| I6I08_RS03835 | 933277..934500 | + | 1224 | WP_075378276.1 | argininosuccinate synthase | - |
| I6I08_RS03840 | 934671..935552 | - | 882 | WP_141406281.1 | formate/nitrite transporter family protein | - |
| I6I08_RS03845 | 935730..937316 | + | 1587 | WP_198498167.1 | argininosuccinate lyase | - |
| I6I08_RS03850 | 937334..938005 | + | 672 | WP_141406280.1 | DNA-3-methyladenine glycosylase | - |
| I6I08_RS03855 | 938146..938571 | + | 426 | WP_141406279.1 | hypothetical protein | - |
| I6I08_RS03860 | 938568..939128 | + | 561 | WP_141406278.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| I6I08_RS03865 | 939118..939732 | + | 615 | WP_141406277.1 | class I SAM-dependent methyltransferase | - |
| I6I08_RS03870 | 939897..941159 | + | 1263 | WP_075378270.1 | tyrosine--tRNA ligase | - |
| I6I08_RS03890 | 947369..947965 | - | 597 | WP_141406818.1 | hypothetical protein | - |
| I6I08_RS03895 | 947933..948781 | + | 849 | WP_141406819.1 | hypothetical protein | - |
| I6I08_RS03900 | 948778..949878 | + | 1101 | WP_141406820.1 | HAD hydrolase-like protein | - |
| I6I08_RS03905 | 949964..950218 | + | 255 | WP_141406821.1 | hypothetical protein | - |
| I6I08_RS03910 | 950220..951092 | + | 873 | WP_075378982.1 | TlyA family RNA methyltransferase | - |
| I6I08_RS03915 | 951218..952177 | + | 960 | WP_141407168.1 | NAD kinase | - |
| I6I08_RS03920 | 952174..953982 | + | 1809 | WP_141406822.1 | DNA repair protein RecN | - |
| I6I08_RS03925 | 953979..955184 | + | 1206 | WP_141406823.1 | hypothetical protein | - |
| I6I08_RS03930 | 955243..956178 | + | 936 | WP_141406824.1 | copper transporter | - |
| I6I08_RS03935 | 956283..957200 | + | 918 | WP_141406825.1 | hypothetical protein | - |
| I6I08_RS03940 | 957200..958846 | + | 1647 | WP_141406826.1 | hypothetical protein | - |
| I6I08_RS03945 | 958843..960000 | + | 1158 | WP_141406827.1 | glycosyltransferase family 4 protein | - |
| I6I08_RS03950 | 960083..960787 | + | 705 | WP_075378988.1 | NUDIX hydrolase | - |
| I6I08_RS03955 | 961055..962068 | + | 1014 | WP_141406828.1 | LacI family DNA-binding transcriptional regulator | - |
| I6I08_RS03960 | 962166..963443 | + | 1278 | WP_141406829.1 | extracellular solute-binding protein | - |
| I6I08_RS03965 | 963562..964479 | + | 918 | WP_141406830.1 | sugar ABC transporter permease | - |
| I6I08_RS03970 | 964601..965452 | + | 852 | WP_141407169.1 | carbohydrate ABC transporter permease | - |
| I6I08_RS03975 | 965739..966920 | + | 1182 | Protein_781 | glycoside hydrolase family 32 protein | - |
| I6I08_RS03980 | 966941..967861 | + | 921 | WP_141406831.1 | glycosyl hydrolase family 32 | - |
| I6I08_RS03985 | 968275..969009 | + | 735 | WP_009747484.1 | helix-turn-helix domain-containing protein | - |
| I6I08_RS03990 | 969006..970445 | + | 1440 | WP_004564693.1 | Fe-S cluster assembly protein SufB | - |
| I6I08_RS03995 | 970538..971797 | + | 1260 | WP_141406832.1 | Fe-S cluster assembly protein SufD | - |
| I6I08_RS04000 | 971866..972615 | + | 750 | WP_004564695.1 | Fe-S cluster assembly ATPase SufC | - |
| I6I08_RS04005 | 972777..974129 | + | 1353 | WP_141406833.1 | SufS family cysteine desulfurase | - |
| I6I08_RS04010 | 974132..974608 | + | 477 | WP_009406112.1 | SUF system NifU family Fe-S cluster assembly protein | - |
| I6I08_RS04015 | 974660..975055 | + | 396 | WP_004564698.1 | metal-sulfur cluster assembly factor | - |
| I6I08_RS04020 | 975084..975479 | - | 396 | WP_141406834.1 | DUF488 family protein | - |
| I6I08_RS04025 | 975554..976393 | - | 840 | WP_141406835.1 | MerR family transcriptional regulator | - |
| I6I08_RS04030 | 976584..977333 | + | 750 | WP_141406836.1 | hypothetical protein | - |
| I6I08_RS04035 | 977445..977792 | + | 348 | WP_141406837.1 | S-adenosylmethionine decarboxylase | - |
| I6I08_RS04040 | 977789..978547 | + | 759 | WP_141406838.1 | hypothetical protein | - |
| I6I08_RS04045 | 978600..978845 | + | 246 | WP_075378997.1 | DUF350 domain-containing protein | - |
| I6I08_RS04050 | 978856..980382 | + | 1527 | WP_141406839.1 | polyamine aminopropyltransferase | - |
| I6I08_RS04055 | 980479..980838 | - | 360 | WP_141406840.1 | hypothetical protein | - |
| I6I08_RS04060 | 980897..981406 | - | 510 | WP_141406841.1 | flavodoxin domain-containing protein | - |
| I6I08_RS04065 | 981599..982507 | - | 909 | WP_004564708.1 | neutral zinc metallopeptidase | - |
| I6I08_RS04070 | 982658..983713 | + | 1056 | WP_004564709.1 | quinone-dependent dihydroorotate dehydrogenase | - |
| I6I08_RS04075 | 983757..984365 | - | 609 | WP_075379002.1 | DUF3043 domain-containing protein | - |
| I6I08_RS04080 | 984407..985795 | + | 1389 | WP_141406842.1 | dipeptidase | - |
| I6I08_RS04085 | 985836..987086 | + | 1251 | WP_141406843.1 | glycerate kinase | - |
| I6I08_RS04090 | 987130..988143 | - | 1014 | WP_075379005.1 | LacI family transcriptional regulator | - |
| I6I08_RS04095 | 988342..989271 | - | 930 | WP_070513228.1 | sugar ABC transporter permease | - |
| I6I08_RS04100 | 989299..990873 | - | 1575 | WP_141406844.1 | ABC transporter permease subunit | - |
| I6I08_RS04105 | 990964..992250 | - | 1287 | WP_081379390.1 | extracellular solute-binding protein | - |
| I6I08_RS04110 | 992363..993589 | - | 1227 | WP_141406845.1 | glycosidase | - |
| I6I08_RS04115 | 993809..995098 | + | 1290 | WP_198498146.1 | deoxyguanosinetriphosphate triphosphohydrolase | - |
| I6I08_RS04120 | 995167..997182 | + | 2016 | WP_141406847.1 | DNA primase | - |
| I6I08_RS04125 | 997233..997799 | + | 567 | WP_004564720.1 | hypothetical protein | - |
| I6I08_RS04135 | 998130..998621 | + | 492 | WP_004564721.1 | peptide deformylase | - |
| I6I08_RS04140 | 998719..999219 | - | 501 | WP_004564722.1 | DUF3145 domain-containing protein | - |
| I6I08_RS04145 | 999395..1000648 | - | 1254 | WP_141406848.1 | beta-ketoacyl-[acyl-carrier-protein] synthase family protein | - |
| I6I08_RS04150 | 1000657..1000908 | - | 252 | WP_070513247.1 | acyl carrier protein | - |
| I6I08_RS04155 | 1001170..1002369 | - | 1200 | WP_198498147.1 | helix-turn-helix domain-containing protein | - |
| I6I08_RS04160 | 1002634..1004112 | + | 1479 | WP_141406850.1 | aspartate ammonia-lyase | - |
| I6I08_RS04165 | 1004210..1004851 | - | 642 | WP_141406851.1 | DUF3060 domain-containing protein | - |
| I6I08_RS04170 | 1004960..1007713 | - | 2754 | WP_141406852.1 | pyruvate dehydrogenase (acetyl-transferring), homodimeric type | - |
| I6I08_RS04175 | 1008111..1008515 | + | 405 | WP_009406144.1 | DUF3052 domain-containing protein | - |
| I6I08_RS04185 | 1008791..1009705 | - | 915 | WP_141406853.1 | alpha/beta hydrolase | - |
| I6I08_RS04190 | 1009736..1009873 | + | 138 | Protein_822 | YdeI/OmpD-associated family protein | - |
| I6I08_RS04195 | 1009972..1011012 | - | 1041 | WP_141406854.1 | DUF1266 domain-containing protein | - |
| I6I08_RS04200 | 1011101..1012273 | - | 1173 | WP_141406855.1 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
| I6I08_RS04205 | 1012471..1013721 | + | 1251 | WP_141406856.1 | DUF1266 domain-containing protein | - |
| I6I08_RS04210 | 1014089..1014316 | + | 228 | WP_141407170.1 | hypothetical protein | - |
| I6I08_RS04215 | 1014369..1015427 | - | 1059 | WP_141406857.1 | virulence RhuM family protein | - |
| I6I08_RS04220 | 1015498..1016367 | - | 870 | WP_141406858.1 | hypothetical protein | - |
| I6I08_RS04225 | 1016433..1017353 | - | 921 | WP_141406859.1 | hypothetical protein | - |
| I6I08_RS04230 | 1017350..1018072 | - | 723 | WP_198498148.1 | HNH endonuclease | - |
| I6I08_RS04235 | 1018871..1019497 | + | 627 | WP_170198622.1 | CDP-alcohol phosphatidyltransferase family protein | - |
| I6I08_RS04240 | 1019494..1020333 | + | 840 | WP_141406861.1 | hypothetical protein | - |
| I6I08_RS04245 | 1020653..1022107 | - | 1455 | WP_141406862.1 | hypothetical protein | - |
| I6I08_RS04250 | 1022288..1022503 | - | 216 | WP_141406863.1 | helix-turn-helix domain-containing protein | - |
| I6I08_RS04255 | 1022607..1023119 | + | 513 | WP_141406864.1 | GNAT family N-acetyltransferase | - |
| I6I08_RS04260 | 1023289..1023630 | + | 342 | WP_141406865.1 | hypothetical protein | - |
| I6I08_RS04265 | 1023648..1024193 | - | 546 | WP_141406866.1 | hypothetical protein | - |
| I6I08_RS04270 | 1024516..1025601 | + | 1086 | WP_141407171.1 | hypothetical protein | - |
| I6I08_RS04275 | 1025725..1025940 | + | 216 | WP_141406867.1 | helix-turn-helix domain-containing protein | - |
| I6I08_RS04280 | 1026070..1026726 | + | 657 | WP_141406868.1 | hypothetical protein | - |
| I6I08_RS04285 | 1027080..1027661 | - | 582 | WP_141406869.1 | hypothetical protein | - |
| I6I08_RS04290 | 1027658..1028848 | - | 1191 | WP_141406870.1 | hypothetical protein | - |
| I6I08_RS04295 | 1028867..1029130 | - | 264 | WP_141406871.1 | hypothetical protein | - |
| I6I08_RS04300 | 1029137..1029397 | - | 261 | WP_141406872.1 | hypothetical protein | - |
| I6I08_RS04305 | 1029420..1029674 | - | 255 | WP_141406873.1 | hypothetical protein | - |
| I6I08_RS04310 | 1029744..1032062 | - | 2319 | WP_141406874.1 | cell division protein FtsK | - |
| I6I08_RS04315 | 1032488..1033612 | + | 1125 | WP_141406875.1 | ISAs1 family transposase | - |
| I6I08_RS04320 | 1033593..1034744 | - | 1152 | WP_141406876.1 | hypothetical protein | - |
| I6I08_RS04325 | 1035341..1036003 | + | 663 | WP_141406877.1 | response regulator transcription factor | - |
| I6I08_RS04330 | 1035996..1037627 | + | 1632 | WP_141406878.1 | ATP-binding protein | - |
| I6I08_RS04335 | 1037560..1038333 | + | 774 | WP_141406879.1 | hypothetical protein | - |
| I6I08_RS04340 | 1038370..1039200 | - | 831 | WP_141406880.1 | DUF4839 domain-containing protein | - |
| I6I08_RS04345 | 1039425..1040291 | - | 867 | WP_141406881.1 | hypothetical protein | - |
| I6I08_RS04350 | 1040578..1040877 | + | 300 | WP_009233120.1 | hypothetical protein | - |
| I6I08_RS04355 | 1040910..1041608 | + | 699 | Protein_855 | hypothetical protein | - |
| I6I08_RS04360 | 1042114..1042791 | + | 678 | WP_141407172.1 | cytosine methyltransferase | - |
| I6I08_RS04365 | 1042837..1043037 | + | 201 | WP_141406883.1 | hypothetical protein | - |
| I6I08_RS04370 | 1044220..1045950 | + | 1731 | WP_141407173.1 | type IV secretion system DNA-binding domain-containing protein | - |
| I6I08_RS04375 | 1046198..1047052 | + | 855 | WP_141406884.1 | replication-relaxation family protein | - |
| I6I08_RS04380 | 1047310..1047846 | + | 537 | WP_141406885.1 | recombinase family protein | - |
| I6I08_RS04385 | 1047839..1049773 | + | 1935 | WP_141406886.1 | recombinase family protein | - |
| I6I08_RS04395 | 1050097..1050465 | + | 369 | WP_075371520.1 | helix-turn-helix domain-containing protein | - |
| I6I08_RS04400 | 1050637..1052307 | - | 1671 | WP_141406887.1 | hypothetical protein | - |
| I6I08_RS04405 | 1053438..1053623 | - | 186 | WP_008732941.1 | helix-turn-helix transcriptional regulator | - |
| I6I08_RS04410 | 1053823..1054980 | - | 1158 | Protein_865 | hypothetical protein | - |
| I6I08_RS04415 | 1055093..1055794 | + | 702 | WP_141406888.1 | hypothetical protein | - |
| I6I08_RS04420 | 1055925..1056200 | + | 276 | WP_141406889.1 | hypothetical protein | - |
| I6I08_RS04425 | 1056549..1058024 | - | 1476 | WP_141406890.1 | serine/threonine protein kinase | - |
| I6I08_RS04430 | 1058254..1059036 | - | 783 | WP_141406891.1 | hypothetical protein | - |
| I6I08_RS04435 | 1059304..1060476 | - | 1173 | WP_198498149.1 | hypothetical protein | - |
| I6I08_RS04440 | 1062495..1063490 | - | 996 | WP_141406893.1 | hypothetical protein | - |
| I6I08_RS04445 | 1064088..1064387 | + | 300 | WP_009233120.1 | hypothetical protein | - |
| I6I08_RS04450 | 1064418..1065116 | + | 699 | Protein_873 | hypothetical protein | - |
| I6I08_RS04455 | 1065693..1066304 | + | 612 | WP_141407175.1 | cytosine methyltransferase | - |
| I6I08_RS04460 | 1066350..1066550 | + | 201 | WP_128831541.1 | hypothetical protein | - |
| I6I08_RS04465 | 1067127..1069436 | + | 2310 | WP_198498150.1 | hypothetical protein | - |
| I6I08_RS04470 | 1070047..1070988 | + | 942 | WP_141407176.1 | replication-relaxation family protein | - |
| I6I08_RS04475 | 1071253..1071792 | + | 540 | WP_141406895.1 | recombinase family protein | - |
| I6I08_RS04480 | 1071785..1073314 | + | 1530 | Protein_879 | recombinase family protein | - |
| I6I08_RS04490 | 1074002..1074904 | + | 903 | WP_075379027.1 | Nif3-like dinuclear metal center hexameric protein | - |
| I6I08_RS04495 | 1074951..1075685 | + | 735 | WP_075379028.1 | hypothetical protein | - |
| I6I08_RS04500 | 1075721..1076530 | - | 810 | WP_075379047.1 | peroxide stress protein YaaA | - |
| I6I08_RS04510 | 1077098..1078291 | - | 1194 | WP_141406896.1 | hypothetical protein | - |
| I6I08_RS04515 | 1078453..1079232 | - | 780 | WP_020991474.1 | type I methionyl aminopeptidase | - |
| I6I08_RS04520 | 1079464..1080312 | - | 849 | WP_075379030.1 | 3-methyl-2-oxobutanoate hydroxymethyltransferase | - |
| I6I08_RS04525 | 1080516..1081847 | + | 1332 | WP_141406897.1 | glutamine synthetase family protein | - |
| I6I08_RS04530 | 1081866..1085462 | + | 3597 | WP_141406898.1 | bifunctional [glutamine synthetase] adenylyltransferase/[glutamine synthetase]-adenylyl-L-tyrosine phosphorylase | - |
| I6I08_RS04535 | 1085558..1086211 | + | 654 | WP_075379033.1 | histidine phosphatase family protein | - |
| I6I08_RS04540 | 1086224..1087024 | - | 801 | WP_141406899.1 | amino acid ABC transporter ATP-binding protein | - |
| I6I08_RS04545 | 1087021..1087986 | - | 966 | WP_075379035.1 | amino acid ABC transporter permease | - |
| I6I08_RS04550 | 1087990..1088910 | - | 921 | WP_075379036.1 | ABC transporter substrate-binding protein | - |
| I6I08_RS04555 | 1089066..1090490 | - | 1425 | WP_075379037.1 | type I glutamate--ammonia ligase | - |
| I6I08_RS04560 | 1090688..1091443 | - | 756 | WP_081379392.1 | DUF4191 domain-containing protein | - |
| I6I08_RS04565 | 1091519..1092550 | - | 1032 | WP_009405909.1 | lipoyl synthase | - |
| I6I08_RS04570 | 1092642..1093343 | - | 702 | WP_075379038.1 | lipoyl(octanoyl) transferase LipB | - |
| I6I08_RS04575 | 1093428..1095170 | + | 1743 | WP_141406900.1 | protein kinase | - |
| I6I08_RS04580 | 1095246..1097514 | - | 2269 | Protein_897 | FAD-dependent oxidoreductase | - |
| I6I08_RS04585 | 1097602..1098222 | + | 621 | WP_075379040.1 | TetR/AcrR family transcriptional regulator | - |
| I6I08_RS04590 | 1098357..1098599 | + | 243 | WP_075374946.1 | hypothetical protein | - |
| I6I08_RS04595 | 1098602..1099576 | + | 975 | WP_141406901.1 | peptidase | - |
| I6I08_RS04600 | 1099721..1101421 | - | 1701 | WP_198498151.1 | 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | - |
| I6I08_RS04605 | 1101452..1102825 | - | 1374 | WP_060957826.1 | dihydrolipoyl dehydrogenase | - |
| I6I08_RS04610 | 1103064..1105076 | - | 2013 | WP_141406903.1 | leucyl aminopeptidase | - |
| I6I08_RS04615 | 1105098..1105652 | + | 555 | WP_009405434.1 | hypothetical protein | - |
| I6I08_RS04620 | 1105707..1107659 | - | 1953 | WP_141406904.1 | chloride channel protein | - |
| I6I08_RS04625 | 1107659..1109686 | - | 2028 | WP_141406905.1 | S9 family peptidase | - |
| I6I08_RS04630 | 1110040..1112097 | + | 2058 | WP_075379212.1 | 1-deoxy-D-xylulose-5-phosphate synthase | - |
| I6I08_RS04635 | 1112483..1114597 | + | 2115 | WP_141406906.1 | formate acetyltransferase | - |
| I6I08_RS04640 | 1114674..1114919 | + | 246 | WP_009406209.1 | autonomous glycyl radical cofactor GrcA2 | - |
| I6I08_RS04645 | 1114943..1115818 | + | 876 | WP_075379214.1 | pyruvate formate lyase-activating protein | - |
| I6I08_RS04650 | 1115929..1117203 | - | 1275 | WP_141407177.1 | HRDC domain-containing protein | - |
| I6I08_RS04655 | 1117275..1117871 | - | 597 | WP_141406907.1 | DUF3000 domain-containing protein | - |
| I6I08_RS04660 | 1118033..1119832 | - | 1800 | WP_141406908.1 | malto-oligosyltrehalose trehalohydrolase | - |
| I6I08_RS04665 | 1119829..1122462 | - | 2634 | WP_141406909.1 | malto-oligosyltrehalose synthase | - |
| I6I08_RS04670 | 1122556..1124763 | - | 2208 | WP_004564794.1 | glycogen debranching protein GlgX | - |
| I6I08_RS04685 | 1125413..1126654 | + | 1242 | WP_141406911.1 | carboxylate--amine ligase | - |
| I6I08_RS04690 | 1126655..1127986 | + | 1332 | WP_141406912.1 | GNAT family N-acetyltransferase | - |
| I6I08_RS04695 | 1128074..1130125 | + | 2052 | WP_141406913.1 | threonine--tRNA ligase | - |
| I6I08_RS04700 | 1130118..1130732 | + | 615 | WP_075379221.1 | HIT domain-containing protein | - |
| I6I08_RS04705 | 1130849..1131481 | + | 633 | WP_075379222.1 | CDP-alcohol phosphatidyltransferase family protein | - |
| I6I08_RS04710 | 1131478..1132476 | + | 999 | WP_141406914.1 | phosphatidylinositol mannoside acyltransferase | - |
| I6I08_RS04715 | 1132473..1133654 | + | 1182 | WP_141406915.1 | glycosyltransferase family 4 protein | - |
| I6I08_RS04720 | 1133687..1134454 | + | 768 | WP_141406916.1 | hypothetical protein | - |
| I6I08_RS04725 | 1134459..1135760 | + | 1302 | WP_141406917.1 | PrsW family intramembrane metalloprotease | - |
| I6I08_RS04730 | 1135924..1136826 | + | 903 | WP_004564804.1 | pyridoxal 5'-phosphate synthase lyase subunit PdxS | - |
| I6I08_RS04735 | 1136823..1137476 | + | 654 | WP_101558114.1 | NUDIX domain-containing protein | - |
| I6I08_RS04740 | 1137486..1138223 | + | 738 | WP_020991492.1 | pyridoxal 5'-phosphate synthase glutaminase subunit PdxT | - |
| I6I08_RS04745 | 1138268..1139032 | + | 765 | WP_004564807.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
| I6I08_RS04750 | 1139037..1139708 | + | 672 | WP_141406918.1 | crossover junction endodeoxyribonuclease RuvC | - |
| I6I08_RS04755 | 1139823..1140476 | + | 654 | WP_141406919.1 | Holliday junction branch migration protein RuvA | - |
| I6I08_RS04760 | 1140469..1141509 | + | 1041 | WP_004564810.1 | Holliday junction branch migration DNA helicase RuvB | - |
| I6I08_RS04765 | 1141685..1142047 | + | 363 | WP_004564811.1 | preprotein translocase subunit YajC | - |
| I6I08_RS04770 | 1142255..1144318 | + | 2064 | WP_141406920.1 | protein translocase subunit SecD | - |
| I6I08_RS04775 | 1144315..1145418 | + | 1104 | WP_141406921.1 | protein translocase subunit SecF | - |
| I6I08_RS04780 | 1145415..1145972 | + | 558 | WP_004564814.1 | adenine phosphoribosyltransferase | - |
| I6I08_RS04785 | 1146117..1148441 | + | 2325 | WP_009747358.1 | bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase | - |
| I6I08_RS04790 | 1149255..1149848 | - | 594 | WP_141406922.1 | hypothetical protein | - |
| I6I08_RS04795 | 1150019..1150891 | + | 873 | WP_141406923.1 | MerR family transcriptional regulator | - |
| I6I08_RS04800 | 1151010..1152671 | - | 1662 | WP_141406924.1 | DUF349 domain-containing protein | - |
| I6I08_RS04805 | 1152965..1154578 | + | 1614 | WP_141406925.1 | ATP-binding cassette domain-containing protein | - |
| I6I08_RS04810 | 1154659..1155474 | + | 816 | WP_141406926.1 | MBL fold metallo-hydrolase | - |
| I6I08_RS04815 | 1155526..1156971 | + | 1446 | WP_075379236.1 | histidine--tRNA ligase | - |
| I6I08_RS04820 | 1156968..1158764 | + | 1797 | WP_075379237.1 | dynamin family protein | - |
| I6I08_RS04825 | 1158761..1160455 | + | 1695 | WP_075379238.1 | 50S ribosome-binding GTPase | - |
| I6I08_RS04830 | 1160540..1161163 | + | 624 | WP_075379239.1 | toxin-antitoxin system HicB family antitoxin | - |
| I6I08_RS04835 | 1161278..1162012 | + | 735 | WP_075379240.1 | DUF4097 family beta strand repeat protein | - |
| I6I08_RS04840 | 1162114..1164711 | - | 2598 | WP_141406927.1 | DEAD/DEAH box helicase | - |
| I6I08_RS04845 | 1165017..1165898 | - | 882 | WP_075379242.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS04850 | 1165903..1166979 | - | 1077 | WP_101558131.1 | ABC transporter permease subunit | - |
| I6I08_RS04855 | 1166986..1168176 | - | 1191 | WP_009406218.1 | ABC transporter substrate-binding protein | - |
| I6I08_RS04860 | 1168770..1170164 | + | 1395 | WP_141407178.1 | DUF3327 domain-containing protein | - |
| I6I08_RS04865 | 1170573..1173071 | + | 2499 | WP_141406928.1 | hypothetical protein | - |
| I6I08_RS04870 | 1173148..1173939 | + | 792 | WP_141406929.1 | DNA-directed RNA polymerase II | - |
| I6I08_RS04875 | 1174046..1175839 | + | 1794 | WP_141406930.1 | aspartate--tRNA ligase | - |
| I6I08_RS04880 | 1176084..1176851 | + | 768 | WP_141407179.1 | alpha/beta hydrolase | - |
| I6I08_RS04885 | 1176929..1178485 | - | 1557 | WP_141406931.1 | serine/threonine protein kinase | - |
| I6I08_RS04890 | 1178708..1179031 | - | 324 | WP_009405546.1 | hypothetical protein | - |
| I6I08_RS04895 | 1179015..1179344 | - | 330 | WP_141406932.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| I6I08_RS04900 | 1179429..1180202 | + | 774 | WP_043537658.1 | glycerophosphoryl diester phosphodiesterase | - |
| I6I08_RS04905 | 1180260..1180877 | + | 618 | WP_075374311.1 | threonylcarbamoyl-AMP synthase | - |
| I6I08_RS04910 | 1180996..1182399 | + | 1404 | WP_075377664.1 | replication-associated recombination protein A | - |
| I6I08_RS04915 | 1182656..1183279 | + | 624 | WP_009747225.1 | 30S ribosomal protein S4 | - |
| I6I08_RS04920 | 1183517..1186228 | + | 2712 | WP_141406933.1 | alanine--tRNA ligase | - |
| I6I08_RS04925 | 1186268..1186783 | + | 516 | WP_004564842.1 | Holliday junction resolvase RuvX | - |
| I6I08_RS04930 | 1186780..1187991 | + | 1212 | WP_009405606.1 | endolytic transglycosylase MltG | - |
| I6I08_RS04935 | 1187984..1188964 | + | 981 | WP_141406934.1 | shikimate dehydrogenase | - |
| I6I08_RS04940 | 1189035..1190267 | + | 1233 | WP_141406935.1 | chorismate synthase | - |
| I6I08_RS04945 | 1190344..1192212 | + | 1869 | WP_141406936.1 | 3-dehydroquinate synthase | - |
| I6I08_RS04950 | 1192209..1192775 | + | 567 | WP_075377670.1 | shikimate kinase | - |
| I6I08_RS04955 | 1192866..1193429 | + | 564 | WP_009405746.1 | elongation factor P | - |
| I6I08_RS04960 | 1193429..1193920 | + | 492 | WP_075377671.1 | transcription antitermination factor NusB | - |
| I6I08_RS04965 | 1194022..1194891 | + | 870 | WP_075377672.1 | hypothetical protein | - |
| I6I08_RS04970 | 1195081..1195782 | + | 702 | WP_075377673.1 | hypothetical protein | - |
| I6I08_RS04975 | 1195930..1196538 | + | 609 | WP_075377674.1 | hypothetical protein | - |
| I6I08_RS04980 | 1196580..1197459 | - | 880 | Protein_975 | glycoside hydrolase family 16 protein | - |
| I6I08_RS04985 | 1197852..1198520 | + | 669 | WP_141406937.1 | bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR | - |
| I6I08_RS04990 | 1198517..1199506 | + | 990 | WP_141406938.1 | aspartate carbamoyltransferase catalytic subunit | - |
| I6I08_RS04995 | 1199503..1200825 | + | 1323 | WP_141406939.1 | dihydroorotase | - |
| I6I08_RS05000 | 1200818..1202041 | + | 1224 | WP_141406940.1 | glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit | - |
| I6I08_RS05005 | 1202043..1205402 | + | 3360 | WP_141406941.1 | carbamoyl-phosphate synthase large subunit | - |
| I6I08_RS05010 | 1205399..1206277 | + | 879 | WP_075377679.1 | orotidine-5'-phosphate decarboxylase | - |
| I6I08_RS05015 | 1206430..1206741 | + | 312 | WP_009406210.1 | hypothetical protein | - |
| I6I08_RS05020 | 1206799..1207392 | + | 594 | WP_075377680.1 | guanylate kinase | - |
| I6I08_RS05025 | 1207438..1207836 | + | 399 | WP_004564860.1 | DNA-directed RNA polymerase subunit omega | - |
| I6I08_RS05030 | 1207849..1209213 | + | 1365 | WP_075377681.1 | bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC | - |
| I6I08_RS05035 | 1209283..1210488 | + | 1206 | WP_075377682.1 | methionine adenosyltransferase | - |
| I6I08_RS05040 | 1210528..1212675 | + | 2148 | WP_081379283.1 | primosomal protein N' | - |
| I6I08_RS05045 | 1212726..1213388 | - | 663 | WP_075377683.1 | TetR family transcriptional regulator | - |
| I6I08_RS05050 | 1213585..1214949 | - | 1365 | WP_075377684.1 | MFS transporter | - |
| I6I08_RS05055 | 1215081..1216094 | - | 1014 | WP_141407180.1 | DMT family transporter | - |
| I6I08_RS05060 | 1216282..1217409 | - | 1128 | WP_075248172.1 | serine/threonine protein kinase | - |
| I6I08_RS05065 | 1217619..1218599 | - | 981 | WP_004564868.1 | carbamate kinase | - |
| I6I08_RS05070 | 1218603..1219610 | - | 1008 | WP_075413879.1 | ornithine carbamoyltransferase | - |
| I6I08_RS05075 | 1219676..1220899 | - | 1224 | WP_141406942.1 | arginine deiminase | - |
| I6I08_RS05080 | 1221243..1221920 | + | 678 | WP_141406943.1 | HAD family phosphatase | - |
| I6I08_RS05085 | 1221960..1222934 | + | 975 | WP_141406944.1 | methionyl-tRNA formyltransferase | - |
| I6I08_RS05090 | 1223174..1224565 | + | 1392 | WP_141406945.1 | rRNA small subunit methyltransferase B | - |
| I6I08_RS05095 | 1224604..1225293 | + | 690 | WP_198498152.1 | ribulose-phosphate 3-epimerase | - |
| I6I08_RS05100 | 1225677..1227512 | + | 1836 | WP_141406946.1 | ATP-grasp domain-containing protein | - |
| I6I08_RS05105 | 1227516..1229147 | + | 1632 | WP_070510789.1 | acyl-CoA carboxylase subunit beta | - |
| I6I08_RS05110 | 1229272..1238724 | + | 9453 | WP_141406947.1 | DUF1729 domain-containing protein | - |
| I6I08_RS05115 | 1238865..1239371 | + | 507 | WP_141406948.1 | holo-ACP synthase | - |
| I6I08_RS05120 | 1239633..1241126 | + | 1494 | WP_141406949.1 | sodium/proline symporter PutP | - |
| I6I08_RS05125 | 1241549..1242544 | + | 996 | WP_065362703.1 | ABC transporter permease subunit | - |
| I6I08_RS05130 | 1242610..1243593 | + | 984 | WP_141406950.1 | ABC transporter substrate-binding protein | - |
| I6I08_RS05135 | 1243650..1244495 | - | 846 | WP_009406030.1 | ATP phosphoribosyltransferase | - |
| I6I08_RS05140 | 1244551..1244814 | - | 264 | WP_010615230.1 | phosphoribosyl-ATP diphosphatase | - |
| I6I08_RS05145 | 1245515..1246165 | + | 651 | WP_141406951.1 | hypothetical protein | - |
| I6I08_RS05150 | 1246429..1247028 | + | 600 | WP_141406952.1 | zinc transporter | - |
| I6I08_RS05155 | 1247252..1248937 | - | 1686 | WP_141406953.1 | hypothetical protein | - |
| I6I08_RS05160 | 1248934..1249725 | - | 792 | WP_141406954.1 | ATP-binding cassette domain-containing protein | - |
| I6I08_RS05165 | 1249824..1250579 | - | 756 | WP_141406955.1 | response regulator transcription factor | - |
| I6I08_RS05170 | 1250576..1251964 | - | 1389 | WP_141406956.1 | two-component sensor histidine kinase | - |
| I6I08_RS05175 | 1251957..1253129 | - | 1173 | WP_141406957.1 | DUF3866 family protein | - |
| I6I08_RS05180 | 1253198..1254244 | + | 1047 | WP_198498153.1 | WYL domain-containing protein | - |
| I6I08_RS05185 | 1254247..1255272 | + | 1026 | WP_141406959.1 | WYL domain-containing protein | - |
| I6I08_RS05190 | 1255400..1255660 | + | 261 | WP_010615218.1 | Sec-independent protein translocase subunit TatA | - |
| I6I08_RS05195 | 1255706..1256515 | + | 810 | WP_141406960.1 | twin-arginine translocase subunit TatC | - |
| I6I08_RS05200 | 1256565..1257548 | + | 984 | WP_010615216.1 | diacylglycerol kinase | - |
| I6I08_RS05205 | 1257558..1260509 | + | 2952 | WP_141406961.1 | DEAD/DEAH box helicase | - |
| I6I08_RS05210 | 1260568..1261485 | + | 918 | WP_141406962.1 | DUF808 domain-containing protein | - |
| I6I08_RS05215 | 1261544..1263181 | + | 1638 | WP_141407182.1 | apolipoprotein N-acyltransferase | - |
| I6I08_RS05220 | 1263248..1264087 | + | 840 | WP_009406341.1 | polyprenol monophosphomannose synthase | - |
| I6I08_RS05225 | 1264094..1264453 | - | 360 | WP_010615210.1 | RNA polymerase-binding protein RbpA | - |
| I6I08_RS05230 | 1264678..1265799 | + | 1122 | WP_141406963.1 | ATP-dependent 6-phosphofructokinase | - |
| I6I08_RS05235 | 1265832..1267121 | - | 1290 | WP_141406964.1 | GNAT family N-acetyltransferase | - |
| I6I08_RS05240 | 1267108..1269517 | - | 2410 | Protein_1027 | excinuclease ABC subunit UvrA | - |
| I6I08_RS05245 | 1269819..1270931 | + | 1113 | WP_075379544.1 | ABC transporter permease | - |
| I6I08_RS05250 | 1270970..1271677 | + | 708 | WP_178389515.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS05255 | 1271722..1272345 | + | 624 | WP_075379546.1 | SGNH/GDSL hydrolase family protein | - |
| I6I08_RS05260 | 1272457..1273488 | + | 1032 | WP_075379547.1 | LacI family DNA-binding transcriptional regulator | - |
| I6I08_RS05265 | 1273572..1275638 | - | 2067 | WP_178389516.1 | PTS beta-glucoside transporter subunit IIBCA | - |
| I6I08_RS05270 | 1275868..1277400 | - | 1533 | WP_075379549.1 | glycoside hydrolase family 32 protein | - |
| I6I08_RS05275 | 1277444..1277689 | - | 246 | WP_081379429.1 | hypothetical protein | - |
| I6I08_RS05280 | 1277686..1278924 | - | 1239 | WP_075379550.1 | inorganic phosphate transporter | - |
| I6I08_RS05285 | 1279233..1280834 | + | 1602 | WP_075379551.1 | Hsp70 family protein | - |
| I6I08_RS05290 | 1280858..1281817 | - | 960 | WP_075379552.1 | aldo/keto reductase | - |
| I6I08_RS05295 | 1281982..1282509 | - | 528 | WP_009397704.1 | MerR family transcriptional regulator | - |
| I6I08_RS05300 | 1282827..1283303 | - | 477 | WP_075379553.1 | bifunctional nuclease family protein | - |
| I6I08_RS05305 | 1283438..1284202 | - | 765 | WP_141406965.1 | MerR family transcriptional regulator | - |
| I6I08_RS05310 | 1284199..1284651 | - | 453 | WP_004564921.1 | FHA domain-containing protein | - |
| I6I08_RS05315 | 1284909..1287608 | - | 2700 | WP_141406966.1 | aminopeptidase N | - |
| I6I08_RS05320 | 1287690..1289165 | - | 1476 | WP_101587271.1 | NADP-dependent phosphogluconate dehydrogenase | - |
| I6I08_RS05325 | 1289583..1291166 | + | 1584 | WP_141406967.1 | glucose-6-phosphate dehydrogenase | - |
| I6I08_RS05330 | 1291163..1292134 | + | 972 | WP_075374094.1 | glucose-6-phosphate dehydrogenase assembly protein OpcA | - |
| I6I08_RS05335 | 1292127..1292921 | + | 795 | WP_141406968.1 | 6-phosphogluconolactonase | - |
| I6I08_RS05340 | 1293004..1294065 | + | 1062 | WP_141406969.1 | HNH endonuclease family protein | - |
| I6I08_RS05345 | 1294088..1294525 | + | 438 | WP_141406970.1 | RNA-binding S4 domain-containing protein | - |
| I6I08_RS05355 | 1295176..1296129 | + | 954 | WP_141406971.1 | CAP domain-containing protein | - |
| I6I08_RS05360 | 1296274..1297143 | + | 870 | WP_141406972.1 | Cof-type HAD-IIB family hydrolase | - |
| I6I08_RS05365 | 1297209..1297508 | - | 300 | WP_141406973.1 | rhodanese-like domain-containing protein | - |
| I6I08_RS05370 | 1297558..1299213 | - | 1656 | WP_075379255.1 | glucose-6-phosphate isomerase | - |
| I6I08_RS05375 | 1299420..1299734 | + | 315 | WP_075379256.1 | hypothetical protein | - |
| I6I08_RS05380 | 1299776..1300591 | - | 816 | WP_075379257.1 | helix-turn-helix domain-containing protein | - |
| I6I08_RS05385 | 1300664..1301176 | + | 513 | WP_075379258.1 | VOC family protein | - |
| I6I08_RS05390 | 1301189..1303348 | - | 2160 | WP_075379352.1 | bifunctional cytidylate kinase/GTPase Der | - |
| I6I08_RS05395 | 1303479..1304639 | - | 1161 | WP_075379259.1 | prephenate dehydrogenase | - |
| I6I08_RS05400 | 1304636..1305610 | - | 975 | WP_141406974.1 | rRNA pseudouridine synthase | - |
| I6I08_RS05405 | 1305607..1306206 | - | 600 | WP_075379261.1 | SMC-Scp complex subunit ScpB | - |
| I6I08_RS05410 | 1306203..1307024 | - | 822 | WP_141406975.1 | segregation/condensation protein A | - |
| I6I08_RS05415 | 1307014..1307886 | - | 873 | WP_075379263.1 | ParA family protein | - |
| I6I08_RS05420 | 1308048..1308971 | - | 924 | WP_075379264.1 | site-specific tyrosine recombinase XerD | - |
| I6I08_RS05425 | 1309063..1309305 | - | 243 | WP_009406441.1 | preprotein translocase subunit SecG | - |
| I6I08_RS05430 | 1309536..1310315 | - | 780 | WP_075379265.1 | triose-phosphate isomerase | - |
| I6I08_RS05435 | 1310331..1311524 | - | 1194 | WP_010615172.1 | phosphoglycerate kinase | - |
| I6I08_RS05440 | 1311637..1312644 | - | 1008 | WP_004564944.1 | type I glyceraldehyde-3-phosphate dehydrogenase | - |
| I6I08_RS05445 | 1312896..1313876 | - | 981 | WP_004564945.1 | DNA-binding protein WhiA | - |
| I6I08_RS05450 | 1314146..1315156 | - | 1011 | WP_075379266.1 | uridine diphosphate-N-acetylglucosamine-binding protein YvcK | - |
| I6I08_RS05455 | 1315160..1316134 | - | 975 | WP_060957942.1 | RNase adapter RapZ | - |
| I6I08_RS05460 | 1316300..1317541 | + | 1242 | WP_141407183.1 | formate-dependent phosphoribosylglycinamide formyltransferase | - |
| I6I08_RS05465 | 1317578..1319041 | - | 1464 | WP_141406976.1 | glycoside hydrolase family 1 protein | - |
| I6I08_RS05470 | 1319112..1320962 | - | 1851 | WP_141406977.1 | beta-glucoside-specific PTS transporter subunit IIABC | - |
| I6I08_RS05475 | 1321153..1321998 | - | 846 | WP_141406978.1 | PRD domain-containing protein | - |
| I6I08_RS05480 | 1322110..1322322 | - | 213 | WP_141406979.1 | molybdopterin-binding protein | - |
| I6I08_RS05485 | 1322377..1324533 | - | 2157 | WP_141406980.1 | excinuclease ABC subunit UvrC | - |
| I6I08_RS05490 | 1324642..1325508 | + | 867 | WP_075379270.1 | Cof-type HAD-IIB family hydrolase | - |
| I6I08_RS05515 | 1326755..1328131 | - | 1377 | WP_075379271.1 | UTP--glucose-1-phosphate uridylyltransferase | - |
| I6I08_RS05520 | 1328338..1330962 | + | 2625 | WP_141406981.1 | DUF2339 domain-containing protein | - |
| I6I08_RS05525 | 1331007..1333853 | - | 2847 | WP_141406982.1 | excinuclease ABC subunit UvrA | - |
| I6I08_RS05530 | 1333993..1334277 | + | 285 | WP_141406983.1 | hypothetical protein | - |
| I6I08_RS05535 | 1334247..1334894 | + | 648 | WP_075379274.1 | class I SAM-dependent methyltransferase | - |
| I6I08_RS05540 | 1334920..1337409 | - | 2490 | WP_141406984.1 | HAD-IC family P-type ATPase | - |
| I6I08_RS05545 | 1337466..1338470 | - | 1005 | WP_141406985.1 | TerC family protein | - |
| I6I08_RS05550 | 1338710..1340806 | - | 2097 | WP_141406986.1 | excinuclease ABC subunit UvrB | - |
| I6I08_RS05555 | 1341161..1341898 | - | 738 | WP_141406987.1 | transcriptional initiation protein Tat | - |
| I6I08_RS05560 | 1342016..1342609 | - | 594 | WP_101558225.1 | dephospho-CoA kinase, long form | - |
| I6I08_RS05565 | 1342766..1344511 | - | 1746 | WP_141406988.1 | hypothetical protein | - |
| I6I08_RS05570 | 1344714..1346168 | - | 1455 | WP_004564961.1 | 30S ribosomal protein S1 | - |
| I6I08_RS05575 | 1346480..1349317 | - | 2838 | WP_141406989.1 | DNA polymerase I | - |
| I6I08_RS05580 | 1349452..1349973 | + | 522 | WP_081379418.1 | PaaI family thioesterase | - |
| I6I08_RS05585 | 1350007..1350615 | - | 609 | WP_009405613.1 | response regulator | - |
| I6I08_RS05595 | 1350788..1351198 | + | 411 | WP_070511471.1 | cytidine deaminase | - |
| I6I08_RS05600 | 1351346..1352776 | - | 1431 | WP_101587222.1 | pyruvate kinase | - |
| I6I08_RS05605 | 1352899..1353915 | - | 1017 | WP_141407184.1 | prolipoprotein diacylglyceryl transferase | - |
| I6I08_RS05610 | 1353961..1354785 | - | 825 | WP_075379305.1 | indole-3-glycerol phosphate synthase TrpC | - |
| I6I08_RS05615 | 1354901..1355263 | - | 363 | WP_178389502.1 | phosphoribosyl-AMP cyclohydrolase | - |
| I6I08_RS05620 | 1355291..1355680 | - | 390 | WP_075379307.1 | DUF2752 domain-containing protein | - |
| I6I08_RS05625 | 1355779..1356180 | - | 402 | WP_075379308.1 | DUF4190 domain-containing protein | - |
| I6I08_RS05630 | 1356778..1357548 | - | 771 | WP_075379309.1 | imidazole glycerol phosphate synthase subunit HisF | - |
| I6I08_RS05635 | 1357545..1358573 | - | 1029 | WP_075379359.1 | hypothetical protein | - |
| I6I08_RS05640 | 1359047..1360486 | - | 1440 | WP_141406990.1 | Pup--protein ligase | - |
| I6I08_RS05645 | 1360489..1360704 | - | 216 | WP_010615145.1 | ubiquitin-like protein Pup | - |
| I6I08_RS05650 | 1360764..1362443 | - | 1680 | WP_075379311.1 | proteasome accessory factor PafA2 family protein | - |
| I6I08_RS05655 | 1362440..1364152 | - | 1713 | WP_075379312.1 | proteasome ATPase | - |
| I6I08_RS05660 | 1364145..1365164 | - | 1020 | WP_198498168.1 | tRNA (adenine-N1)-methyltransferase | - |
| I6I08_RS05665 | 1365266..1366060 | - | 795 | WP_010615140.1 | bacteriocin family protein | - |
| I6I08_RS05670 | 1366057..1367196 | - | 1140 | WP_141406992.1 | Dyp-type peroxidase | - |
| I6I08_RS05675 | 1367356..1368477 | - | 1122 | WP_141406993.1 | peptidase M50 | - |
| I6I08_RS05680 | 1368750..1369562 | + | 813 | WP_141407185.1 | PD-(D/E)XK nuclease family protein | - |
| I6I08_RS05685 | 1369950..1371035 | + | 1086 | WP_141406994.1 | YeeE/YedE family protein | - |
| I6I08_RS05690 | 1371116..1371337 | + | 222 | WP_010615135.1 | sulfurtransferase TusA family protein | - |
| I6I08_RS05695 | 1371361..1372341 | + | 981 | WP_075379315.1 | aldo/keto reductase | - |
| I6I08_RS05700 | 1372381..1373139 | - | 759 | WP_141406995.1 | ATP-binding cassette domain-containing protein | - |
| I6I08_RS05705 | 1373136..1374119 | - | 984 | WP_141406996.1 | iron chelate uptake ABC transporter family permease subunit | - |
| I6I08_RS05710 | 1374112..1375134 | - | 1023 | WP_141406997.1 | iron chelate uptake ABC transporter family permease subunit | - |
| I6I08_RS05715 | 1375131..1376222 | - | 1092 | WP_141406998.1 | siderophore ABC transporter substrate-binding protein | - |
| I6I08_RS05720 | 1376411..1376728 | - | 318 | WP_075379318.1 | DNA primase | - |
| I6I08_RS05725 | 1376800..1377900 | - | 1101 | WP_141406999.1 | FAD-dependent oxidoreductase | - |
| I6I08_RS05730 | 1377949..1380000 | - | 2052 | WP_075379364.1 | M3 family metallopeptidase | - |
| I6I08_RS05735 | 1380125..1381867 | + | 1743 | WP_075379320.1 | pyruvate dehydrogenase | - |
| I6I08_RS05740 | 1381876..1382424 | - | 549 | WP_075379321.1 | TetR/AcrR family transcriptional regulator | - |
| I6I08_RS05745 | 1382421..1383941 | - | 1521 | WP_170198632.1 | MFS transporter | - |
| I6I08_RS05750 | 1383991..1385130 | - | 1140 | WP_141407001.1 | GNAT family N-acetyltransferase | - |
| I6I08_RS05755 | 1385250..1386599 | + | 1350 | WP_141407002.1 | hypothetical protein | - |
| I6I08_RS05760 | 1386609..1387871 | - | 1263 | WP_141407003.1 | MFS transporter | - |
| I6I08_RS05765 | 1388082..1388651 | + | 570 | WP_141407004.1 | DUF805 domain-containing protein | - |
| I6I08_RS05770 | 1388955..1389452 | + | 498 | WP_141407005.1 | DUF805 domain-containing protein | - |
| I6I08_RS05780 | 1389722..1390633 | - | 912 | WP_075379328.1 | D-hexose-6-phosphate mutarotase | - |
| I6I08_RS05785 | 1390703..1392160 | + | 1458 | WP_075379329.1 | AI-2E family transporter | - |
| I6I08_RS05790 | 1392173..1395580 | - | 3408 | WP_141407006.1 | error-prone DNA polymerase | - |
| I6I08_RS05795 | 1395604..1398147 | - | 2544 | WP_141407007.1 | HNH endonuclease | - |
| I6I08_RS05800 | 1398578..1399384 | - | 807 | WP_141407008.1 | hypothetical protein | - |
| I6I08_RS05805 | 1399381..1400079 | - | 699 | WP_101558255.1 | hypothetical protein | - |
| I6I08_RS05810 | 1400210..1400860 | - | 651 | WP_141407009.1 | thymidine kinase | - |
| I6I08_RS05815 | 1401008..1401751 | + | 744 | WP_141407010.1 | phosphatase PAP2 family protein | - |
| I6I08_RS05820 | 1401716..1403416 | - | 1701 | WP_141407011.1 | DNA polymerase Y family protein | - |
| I6I08_RS05825 | 1403413..1404327 | - | 915 | WP_075379336.1 | hypothetical protein | - |
| I6I08_RS05830 | 1404557..1405132 | + | 576 | WP_075379337.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
| I6I08_RS05835 | 1405129..1405992 | + | 864 | WP_075375020.1 | SDR family oxidoreductase | - |
| I6I08_RS05840 | 1406014..1406472 | - | 459 | WP_065362145.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| I6I08_RS05845 | 1406517..1407299 | - | 783 | WP_075379338.1 | ABC transporter permease | - |
| I6I08_RS05850 | 1407299..1408045 | - | 747 | WP_081379420.1 | ABC transporter permease | - |
| I6I08_RS05855 | 1408054..1409049 | - | 996 | WP_075379340.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS05860 | 1409388..1410041 | + | 654 | WP_141407186.1 | GNAT family N-acetyltransferase | - |
| I6I08_RS05865 | 1410048..1410641 | + | 594 | WP_141407012.1 | hypothetical protein | - |
| I6I08_RS05870 | 1410685..1412136 | - | 1452 | WP_141407013.1 | FAD-dependent oxidoreductase | - |
| I6I08_RS05875 | 1412339..1412920 | - | 582 | WP_141407014.1 | TetR/AcrR family transcriptional regulator | - |
| I6I08_RS05880 | 1412902..1413849 | - | 948 | WP_075379344.1 | alpha/beta fold hydrolase | - |
| I6I08_RS05885 | 1413965..1416637 | - | 2673 | WP_141407015.1 | aconitate hydratase AcnA | - |
| I6I08_RS05890 | 1416877..1418274 | - | 1398 | WP_141407016.1 | class I SAM-dependent RNA methyltransferase | - |
| I6I08_RS05895 | 1418271..1420388 | - | 2118 | WP_141407017.1 | APC family permease | - |
| I6I08_RS05900 | 1420453..1421103 | + | 651 | WP_198498169.1 | TrkA family potassium uptake protein | - |
| I6I08_RS05905 | 1421107..1421769 | + | 663 | WP_004565026.1 | TrkA family potassium uptake protein | - |
| I6I08_RS05910 | 1421785..1422561 | - | 777 | WP_141407019.1 | DUF3159 domain-containing protein | - |
| I6I08_RS05915 | 1422595..1422972 | - | 378 | WP_060957999.1 | OB-fold nucleic acid binding domain-containing protein | - |
| I6I08_RS05920 | 1422973..1423677 | - | 705 | WP_141407020.1 | DUF3710 domain-containing protein | - |
| I6I08_RS05925 | 1423705..1424010 | - | 306 | WP_004565030.1 | DUF4193 domain-containing protein | - |
| I6I08_RS05930 | 1424331..1425809 | + | 1479 | WP_075379350.1 | DUF3071 domain-containing protein | - |
| I6I08_RS05935 | 1425818..1427161 | - | 1344 | WP_141407021.1 | alkaline phosphatase family protein | - |
| I6I08_RS05940 | 1427173..1427793 | - | 621 | WP_198498154.1 | hypothetical protein | - |
| I6I08_RS05945 | 1427945..1430488 | + | 2544 | WP_141407022.1 | DNA topoisomerase IV subunit A | - |
| I6I08_RS05950 | 1430556..1432199 | + | 1644 | WP_198498155.1 | amidohydrolase family protein | - |
| I6I08_RS05955 | 1432225..1433277 | - | 1053 | WP_141407023.1 | GNAT family N-acetyltransferase | - |
| I6I08_RS05960 | 1433407..1435659 | - | 2253 | WP_141407024.1 | type IIA DNA topoisomerase subunit B | - |
| I6I08_RS05965 | 1435761..1436537 | - | 777 | WP_141407025.1 | hypothetical protein | - |
| I6I08_RS05970 | 1436731..1437003 | + | 273 | WP_010615084.1 | hypothetical protein | - |
| I6I08_RS05975 | 1437248..1437655 | + | 408 | WP_141407026.1 | rhodanese-like domain-containing protein | - |
| I6I08_RS05980 | 1437703..1438605 | - | 903 | WP_141407027.1 | arginase family protein | - |
| I6I08_RS05985 | 1438852..1439193 | + | 342 | WP_141407028.1 | hypothetical protein | - |
| I6I08_RS05990 | 1439206..1440303 | - | 1098 | WP_081379320.1 | trypsin-like peptidase domain-containing protein | - |
| I6I08_RS05995 | 1440415..1441260 | - | 846 | WP_075378130.1 | bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase | - |
| I6I08_RS06000 | 1441257..1441919 | - | 663 | WP_075378131.1 | thiamine phosphate synthase | - |
| I6I08_RS06005 | 1441916..1442758 | - | 843 | WP_170198624.1 | hydroxyethylthiazole kinase | - |
| I6I08_RS06010 | 1442928..1444550 | - | 1623 | WP_075378132.1 | RNA polymerase sigma factor | - |
| I6I08_RS06015 | 1444776..1445936 | + | 1161 | WP_101587106.1 | polyprenyl synthetase family protein | - |
| I6I08_RS06020 | 1446036..1448063 | + | 2028 | WP_101587103.1 | Stk1 family PASTA domain-containing Ser/Thr kinase | - |
| I6I08_RS06025 | 1448141..1449505 | - | 1365 | WP_075378135.1 | 3-deoxy-7-phosphoheptulonate synthase class II | - |
| I6I08_RS06030 | 1449808..1451037 | - | 1230 | WP_075378136.1 | pyrophosphate--fructose-6-phosphate 1-phosphotransferase | - |
| I6I08_RS06035 | 1451198..1452076 | - | 879 | WP_070510158.1 | 1-acyl-sn-glycerol-3-phosphate acyltransferase | - |
| I6I08_RS06040 | 1452288..1453925 | + | 1638 | WP_141407189.1 | DEDD exonuclease domain-containing protein | - |
| I6I08_RS06045 | 1453972..1454415 | - | 444 | WP_004565060.1 | hypothetical protein | - |
| I6I08_RS06050 | 1454596..1455219 | + | 624 | WP_075414202.1 | superoxide dismutase | - |
| I6I08_RS06055 | 1455323..1456315 | - | 993 | WP_141407029.1 | FKBP-type peptidyl-prolyl cis-trans isomerase | - |
| I6I08_RS06060 | 1456356..1456748 | - | 393 | WP_141407030.1 | iron-sulfur cluster assembly accessory protein | - |
| I6I08_RS06065 | 1456984..1458642 | - | 1659 | WP_176747172.1 | ATP-binding cassette domain-containing protein | - |
| I6I08_RS06070 | 1458691..1459347 | - | 657 | WP_141407031.1 | hypothetical protein | - |
| I6I08_RS06075 | 1459723..1461867 | + | 2145 | WP_141407032.1 | glucose PTS transporter subunit IIA | - |
| I6I08_RS06080 | 1462010..1462870 | - | 861 | WP_141407033.1 | RNA methyltransferase | - |
| I6I08_RS06085 | 1463019..1464317 | - | 1299 | WP_141407034.1 | SPFH/Band 7/PHB domain protein | - |
| I6I08_RS06090 | 1464378..1464845 | - | 468 | WP_075374684.1 | NfeD family protein | - |
| I6I08_RS06095 | 1464952..1465773 | - | 822 | WP_141407035.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS06100 | 1465895..1466635 | + | 741 | WP_141407036.1 | hypothetical protein | - |
| I6I08_RS06105 | 1466693..1467922 | - | 1230 | WP_141407037.1 | glycogen synthase | - |
| I6I08_RS06110 | 1468272..1469516 | + | 1245 | WP_141407038.1 | glucose-1-phosphate adenylyltransferase | - |
| I6I08_RS06115 | 1469614..1470324 | + | 711 | WP_141407039.1 | phosphoserine phosphatase SerB | - |
| I6I08_RS06120 | 1470353..1470853 | - | 501 | WP_009406005.1 | histidine phosphatase family protein | - |
| I6I08_RS06125 | 1470939..1471667 | - | 729 | WP_176747033.1 | SDR family oxidoreductase | - |
| I6I08_RS06130 | 1471849..1473147 | + | 1299 | WP_141407190.1 | tRNA dihydrouridine synthase DusB | - |
| I6I08_RS06135 | 1473193..1474521 | - | 1329 | WP_141407040.1 | YibE/F family protein | - |
| I6I08_RS06140 | 1474636..1476027 | - | 1392 | WP_060958027.1 | glycine--tRNA ligase | - |
| I6I08_RS06145 | 1476255..1477331 | + | 1077 | WP_141407041.1 | metal ABC transporter substrate-binding protein | - |
| I6I08_RS06150 | 1477405..1478343 | + | 939 | WP_141407042.1 | metal ABC transporter ATP-binding protein | - |
| I6I08_RS06155 | 1478340..1479230 | + | 891 | WP_141407043.1 | metal ABC transporter permease | - |
| I6I08_RS06160 | 1479227..1479652 | + | 426 | WP_070512659.1 | transcriptional repressor | - |
| I6I08_RS06165 | 1480152..1481021 | - | 870 | WP_141407044.1 | di-trans,poly-cis-decaprenylcistransferase | - |
| I6I08_RS06170 | 1481024..1481773 | - | 750 | WP_009747607.1 | DNA repair protein RecO | - |
| I6I08_RS06175 | 1481796..1483577 | - | 1782 | WP_141407045.1 | 2-isopropylmalate synthase | - |
| I6I08_RS06180 | 1483952..1484806 | + | 855 | WP_141407046.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS06185 | 1484803..1485639 | + | 837 | WP_141407047.1 | ABC transporter permease | - |
| I6I08_RS06190 | 1485642..1485866 | + | 225 | WP_020991564.1 | helix-turn-helix transcriptional regulator | - |
| I6I08_RS06195 | 1485874..1486233 | - | 360 | WP_170198625.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| I6I08_RS06200 | 1486599..1490171 | - | 3573 | WP_141407049.1 | bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase | - |
| I6I08_RS06205 | 1490328..1491632 | - | 1305 | WP_141407050.1 | GTPase Era | - |
| I6I08_RS06210 | 1491625..1492911 | - | 1287 | WP_141407051.1 | hemolysin family protein | - |
| I6I08_RS06215 | 1492919..1493377 | - | 459 | WP_004565094.1 | rRNA maturation RNase YbeY | - |
| I6I08_RS06220 | 1493367..1494560 | - | 1194 | WP_198498156.1 | PhoH family protein | - |
| I6I08_RS06225 | 1494796..1495395 | + | 600 | WP_141407192.1 | DUF1819 family protein | - |
| I6I08_RS06230 | 1495392..1496006 | + | 615 | WP_198498157.1 | DUF1788 domain-containing protein | - |
| I6I08_RS06235 | 1496012..1499530 | + | 3519 | WP_141407194.1 | BREX system P-loop protein BrxC | - |
| I6I08_RS06240 | 1499527..1503120 | + | 3594 | WP_198498158.1 | BREX-1 system adenine-specific DNA-methyltransferase PglX | - |
| I6I08_RS06245 | 1503117..1505516 | + | 2400 | WP_141407052.1 | AAA family ATPase | - |
| I6I08_RS06250 | 1505513..1507009 | + | 1497 | WP_141407053.1 | helix-turn-helix domain-containing protein | - |
| I6I08_RS06255 | 1507015..1509540 | + | 2526 | WP_170198626.1 | BREX-1 system phosphatase PglZ type A | - |
| I6I08_RS06260 | 1509550..1511667 | + | 2118 | WP_141407055.1 | BREX system Lon protease-like protein BrxL | - |
| I6I08_RS06265 | 1511756..1512628 | - | 873 | WP_141407056.1 | EamA family transporter | - |
| I6I08_RS06270 | 1512715..1513461 | - | 747 | WP_075378166.1 | ABC transporter permease | - |
| I6I08_RS06275 | 1513461..1514294 | - | 834 | WP_198498159.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS06280 | 1514503..1515120 | - | 618 | WP_141407057.1 | TetR family transcriptional regulator | - |
| I6I08_RS06285 | 1515268..1515627 | - | 360 | WP_075378168.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| I6I08_RS06290 | 1515603..1515872 | - | 270 | WP_075378169.1 | hypothetical protein | - |
| I6I08_RS06295 | 1515914..1516726 | - | 813 | WP_075378170.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| I6I08_RS06300 | 1516787..1517584 | + | 798 | WP_141407058.1 | YggS family pyridoxal phosphate-dependent enzyme | - |
| I6I08_RS06305 | 1517600..1518724 | - | 1125 | WP_141407059.1 | molecular chaperone DnaJ | - |
| I6I08_RS06310 | 1518816..1519901 | - | 1086 | WP_075378173.1 | heat-inducible transcriptional repressor HrcA | - |
| I6I08_RS06315 | 1520073..1521149 | + | 1077 | WP_141407060.1 | DUF3097 domain-containing protein | - |
| I6I08_RS06320 | 1521352..1522773 | - | 1422 | WP_141407061.1 | sodium:proton antiporter | - |
| I6I08_RS06325 | 1522909..1523952 | - | 1044 | WP_141407062.1 | ferrochelatase | - |
| I6I08_RS06330 | 1524107..1524739 | - | 633 | WP_075378178.1 | hypothetical protein | - |
| I6I08_RS06335 | 1525447..1526733 | - | 1287 | WP_141407063.1 | coproporphyrinogen III oxidase | - |
| I6I08_RS06340 | 1526730..1528046 | - | 1317 | WP_141407064.1 | MFS transporter | - |
| I6I08_RS06345 | 1528043..1529053 | - | 1011 | WP_141407065.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
| I6I08_RS06350 | 1529130..1529945 | - | 816 | WP_141407066.1 | MOSC domain-containing protein | - |
| I6I08_RS06355 | 1530041..1531897 | - | 1857 | WP_178384996.1 | translation elongation factor 4 | - |
| I6I08_RS06360 | 1532137..1532625 | + | 489 | WP_075378184.1 | VTT domain-containing protein | - |
| I6I08_RS06365 | 1532774..1534363 | + | 1590 | WP_141407067.1 | S8 family peptidase | - |
| I6I08_RS06370 | 1534638..1536431 | + | 1794 | WP_141407068.1 | anthranilate synthase component 1 | - |
| I6I08_RS06375 | 1536435..1537142 | + | 708 | WP_198498160.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
| I6I08_RS06380 | 1537256..1538344 | + | 1089 | WP_141407069.1 | anthranilate phosphoribosyltransferase | - |
| I6I08_RS06385 | 1538354..1540621 | + | 2268 | WP_141407070.1 | tryptophan synthase subunit beta | - |
| I6I08_RS06390 | 1540623..1541498 | + | 876 | WP_141407071.1 | tryptophan synthase subunit alpha | - |
| I6I08_RS06395 | 1541625..1542293 | + | 669 | WP_075378190.1 | hypothetical protein | - |
| I6I08_RS06400 | 1542543..1544015 | + | 1473 | WP_170198633.1 | hypothetical protein | - |
| I6I08_RS06405 | 1544218..1545729 | + | 1512 | WP_141407073.1 | hypothetical protein | - |
| I6I08_RS06410 | 1545897..1546550 | + | 654 | WP_141407074.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| I6I08_RS06415 | 1546791..1547051 | + | 261 | WP_009396927.1 | 30S ribosomal protein S20 | - |
| I6I08_RS06420 | 1547159..1548646 | + | 1488 | WP_141407075.1 | DUF1846 domain-containing protein | - |
| I6I08_RS06425 | 1548994..1550082 | + | 1089 | WP_141407076.1 | bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD | - |
| I6I08_RS06430 | 1550082..1550741 | + | 660 | WP_141407077.1 | riboflavin synthase | - |
| I6I08_RS06435 | 1550735..1552066 | + | 1332 | WP_141407078.1 | bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II | - |
| I6I08_RS06440 | 1552063..1552536 | + | 474 | WP_141407079.1 | 6,7-dimethyl-8-ribityllumazine synthase | - |
| I6I08_RS06445 | 1552544..1553500 | - | 957 | WP_141407198.1 | DNA polymerase III subunit delta | - |
| I6I08_RS06450 | 1553443..1555335 | - | 1893 | WP_141407080.1 | ComEC/Rec2 family competence protein | - |
| I6I08_RS06455 | 1555332..1556105 | - | 774 | WP_141407199.1 | ComEA family DNA-binding protein | - |
| I6I08_RS06460 | 1556263..1557138 | - | 876 | WP_141407081.1 | DegV family protein | - |
| I6I08_RS06465 | 1557208..1558464 | - | 1257 | WP_070512558.1 | glycosyltransferase | - |
| I6I08_RS06470 | 1558731..1560743 | + | 2013 | WP_141407082.1 | DUF853 family protein | - |
| I6I08_RS06475 | 1560865..1563846 | - | 2982 | WP_141407083.1 | leucine--tRNA ligase | - |
| I6I08_RS06480 | 1564251..1566660 | + | 2410 | Protein_1268 | DUF222 domain-containing protein | - |
| I6I08_RS06485 | 1566687..1567133 | - | 447 | WP_075378203.1 | HIT family protein | - |
| I6I08_RS06490 | 1567665..1568588 | - | 924 | WP_075390765.1 | Abi family protein | - |
| I6I08_RS06495 | 1568763..1569527 | - | 765 | WP_141407084.1 | metal-dependent transcriptional regulator | - |
| I6I08_RS06500 | 1569524..1570258 | - | 735 | WP_141407085.1 | vitamin K epoxide reductase family protein | - |
| I6I08_RS06505 | 1570352..1572367 | - | 2016 | WP_141407086.1 | serine/threonine protein phosphatase | - |
| I6I08_RS06510 | 1572376..1573233 | - | 858 | WP_141407087.1 | HAD hydrolase family protein | - |
| I6I08_RS06515 | 1573349..1573522 | - | 174 | WP_010614985.1 | methionine/alanine import family NSS transporter small subunit | - |
| I6I08_RS06520 | 1573524..1575104 | - | 1581 | WP_141407088.1 | sodium-dependent transporter | - |
| I6I08_RS06525 | 1575332..1576054 | + | 723 | WP_141407089.1 | purine-nucleoside phosphorylase | - |
| I6I08_RS06530 | 1576428..1576706 | + | 279 | WP_004565152.1 | DUF1540 domain-containing protein | - |
| I6I08_RS06535 | 1576824..1577711 | - | 888 | WP_141407090.1 | hypothetical protein | - |
| I6I08_RS06540 | 1577838..1578485 | - | 648 | WP_141407091.1 | MarC family protein | - |
| I6I08_RS06555 | 1578852..1579493 | - | 642 | WP_075374611.1 | histidine phosphatase family protein | - |
| I6I08_RS06560 | 1579490..1579909 | - | 420 | WP_004565156.1 | ribosome silencing factor | - |
| I6I08_RS06565 | 1579976..1581664 | - | 1689 | WP_141407092.1 | hypothetical protein | - |
| I6I08_RS06570 | 1581654..1582337 | - | 684 | WP_004565158.1 | nicotinate-nucleotide adenylyltransferase | - |
| I6I08_RS06575 | 1582516..1583595 | - | 1080 | WP_070512522.1 | ROK family protein | - |
| I6I08_RS06580 | 1583879..1584655 | + | 777 | WP_141407093.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| I6I08_RS06585 | 1584768..1586060 | + | 1293 | WP_141407094.1 | glycosyl transferase family 28 | - |
| I6I08_RS06590 | 1586057..1587352 | + | 1296 | WP_141407095.1 | glycosyltransferase | - |
| I6I08_RS06595 | 1587352..1588521 | + | 1170 | WP_141407096.1 | glycosyltransferase family 4 protein | - |
| I6I08_RS06600 | 1588572..1590347 | + | 1776 | WP_141407097.1 | ABC transporter ATP-binding protein/permease | - |
| I6I08_RS06605 | 1590344..1591561 | + | 1218 | WP_141407098.1 | aminoglycoside phosphotransferase family protein | - |
| I6I08_RS06610 | 1591594..1592655 | + | 1062 | WP_141407099.1 | phosphotransferase | - |
| I6I08_RS06615 | 1592652..1593980 | + | 1329 | WP_141407100.1 | UDP-glucose/GDP-mannose dehydrogenase family protein | - |
| I6I08_RS06620 | 1594055..1595584 | + | 1530 | WP_141407101.1 | HAMP domain-containing histidine kinase | - |
| I6I08_RS06625 | 1595581..1596240 | + | 660 | WP_009405416.1 | response regulator transcription factor | - |
| I6I08_RS06630 | 1596274..1596771 | - | 498 | WP_141407102.1 | ubiquitin carboxyl-hydrolase | - |
| I6I08_RS06635 | 1596954..1598249 | - | 1296 | WP_141407103.1 | glutamate-5-semialdehyde dehydrogenase | - |
| I6I08_RS06640 | 1598284..1599378 | - | 1095 | WP_141407200.1 | glutamate 5-kinase | - |
| I6I08_RS06645 | 1599450..1601072 | - | 1623 | WP_075374417.1 | GTPase ObgE | - |
| I6I08_RS06650 | 1601159..1601416 | - | 258 | WP_003785909.1 | 50S ribosomal protein L27 | - |
| I6I08_RS06655 | 1601486..1601806 | - | 321 | WP_004565174.1 | 50S ribosomal protein L21 | - |
| I6I08_RS06660 | 1601983..1605258 | - | 3276 | WP_141407104.1 | Rne/Rng family ribonuclease | - |
| I6I08_RS06665 | 1605880..1607439 | + | 1560 | WP_075415048.1 | cytochrome ubiquinol oxidase subunit I | - |
| I6I08_RS06670 | 1607461..1608594 | + | 1134 | WP_141407105.1 | cytochrome d ubiquinol oxidase subunit II | - |
| I6I08_RS06675 | 1608661..1610436 | + | 1776 | WP_198498089.1 | thiol reductant ABC exporter subunit CydD | - |
| I6I08_RS06680 | 1610478..1612346 | + | 1869 | WP_198498170.1 | thiol reductant ABC exporter subunit CydC | - |
| I6I08_RS06685 | 1612361..1614454 | + | 2094 | WP_075378223.1 | GAF domain-containing protein | - |
| I6I08_RS06690 | 1614502..1615161 | - | 660 | WP_020991587.1 | response regulator transcription factor | - |
| I6I08_RS06695 | 1615263..1616339 | - | 1077 | WP_141407107.1 | bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase | - |
| I6I08_RS06700 | 1616339..1617133 | - | 795 | WP_075378225.1 | ribonuclease III | - |
| I6I08_RS06705 | 1617133..1617723 | - | 591 | WP_004565184.1 | DUF177 domain-containing protein | - |
| I6I08_RS06710 | 1617922..1618473 | - | 552 | WP_141407108.1 | ATP synthase F0 subunit B | - |
| I6I08_RS06715 | 1618470..1619057 | - | 588 | WP_141407109.1 | pantetheine-phosphate adenylyltransferase | - |
| I6I08_RS06720 | 1619172..1620170 | + | 999 | WP_141407110.1 | LacI family transcriptional regulator | - |
| I6I08_RS06725 | 1620283..1621611 | - | 1329 | WP_141407111.1 | L-fucose:H+ symporter permease | - |
| I6I08_RS06730 | 1621611..1622039 | - | 429 | WP_141407112.1 | fucose isomerase | - |
| I6I08_RS06735 | 1622104..1623573 | - | 1470 | WP_141407113.1 | carbohydrate kinase | - |
| I6I08_RS06740 | 1623586..1625361 | - | 1776 | WP_141407114.1 | L-fucose isomerase | - |
| I6I08_RS06745 | 1625570..1626238 | + | 669 | WP_141407115.1 | class II aldolase/adducin family protein | - |
| I6I08_RS06750 | 1626289..1626849 | + | 561 | WP_141407116.1 | 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD | - |
| I6I08_RS06755 | 1626884..1629142 | - | 2259 | WP_141407202.1 | ATP-dependent DNA helicase RecG | - |
| I6I08_RS06760 | 1629307..1631259 | - | 1953 | WP_141407117.1 | DAK2 domain-containing protein | - |
| I6I08_RS06765 | 1631778..1631969 | + | 192 | WP_003785965.1 | 50S ribosomal protein L28 | - |
| I6I08_RS06770 | 1632066..1633175 | - | 1110 | WP_141407118.1 | thiamine-phosphate kinase | - |
| I6I08_RS06775 | 1633162..1634328 | - | 1167 | WP_020991592.1 | D-alanine--D-alanine ligase | - |
| I6I08_RS06780 | 1634414..1635469 | - | 1056 | WP_070512470.1 | NAD(P)-dependent glycerol-3-phosphate dehydrogenase | - |
| I6I08_RS06785 | 1635466..1636233 | - | 768 | WP_141407203.1 | 1-acyl-sn-glycerol-3-phosphate acyltransferase | - |
| I6I08_RS06790 | 1636357..1637679 | - | 1323 | WP_141407119.1 | UDP-N-acetylglucosamine 1-carboxyvinyltransferase | - |
| I6I08_RS06795 | 1637927..1638580 | - | 654 | WP_004565201.1 | 3-isopropylmalate dehydratase small subunit | - |
| I6I08_RS06800 | 1638661..1640154 | - | 1494 | WP_075378230.1 | 3-isopropylmalate dehydratase large subunit | - |
| I6I08_RS06805 | 1640359..1641108 | + | 750 | WP_004565203.1 | IclR family transcriptional regulator | - |
| I6I08_RS06810 | 1641171..1642313 | - | 1143 | WP_141407120.1 | glycosyltransferase | - |
| I6I08_RS06815 | 1642397..1642852 | - | 456 | WP_020991593.1 | transcriptional regulator NrdR | - |
| I6I08_RS06820 | 1642960..1643709 | - | 750 | WP_141407121.1 | LysM peptidoglycan-binding domain-containing protein | - |
| I6I08_RS06825 | 1643923..1644711 | + | 789 | WP_141407122.1 | transcriptional repressor LexA | - |
| I6I08_RS06830 | 1644785..1645786 | - | 1002 | WP_075378235.1 | L-lactate dehydrogenase | - |
| I6I08_RS06835 | 1645905..1647965 | - | 2061 | WP_141407123.1 | ATP-dependent DNA helicase | - |
| I6I08_RS06840 | 1647974..1649605 | - | 1632 | WP_141407124.1 | GTPase HflX | - |
| I6I08_RS06845 | 1649753..1651126 | - | 1374 | WP_141407125.1 | MFS transporter | - |
| I6I08_RS06850 | 1651159..1651767 | + | 609 | WP_141407126.1 | methyltransferase | - |
| I6I08_RS06855 | 1651742..1653268 | - | 1527 | WP_141407127.1 | MFS transporter | - |
| I6I08_RS06860 | 1653297..1654700 | - | 1404 | WP_141407128.1 | branched-chain amino acid transport system II carrier protein | - |
| I6I08_RS06865 | 1654783..1655733 | - | 951 | WP_141407129.1 | diaminopimelate epimerase | - |
| I6I08_RS06870 | 1655744..1656739 | - | 996 | WP_141407130.1 | tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA | - |
| I6I08_RS06875 | 1656745..1657533 | - | 789 | WP_141407131.1 | YbjN domain-containing protein | - |
| I6I08_RS06880 | 1657533..1658003 | - | 471 | WP_004565218.1 | YbjN domain-containing protein | - |
| I6I08_RS06885 | 1658089..1659750 | - | 1662 | WP_141407132.1 | tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB | - |
| I6I08_RS06890 | 1659926..1662847 | + | 2922 | WP_141407133.1 | aminomethyl-transferring glycine dehydrogenase | - |
| I6I08_RS06895 | 1662878..1664143 | + | 1266 | WP_141407134.1 | glycine cleavage system protein T | - |
| I6I08_RS06900 | 1664189..1664575 | + | 387 | WP_060956458.1 | glycine cleavage system protein GcvH | - |
| I6I08_RS06905 | 1664580..1666103 | - | 1524 | WP_141407135.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| I6I08_RS06910 | 1666202..1667929 | - | 1728 | WP_141407136.1 | formate--tetrahydrofolate ligase | - |
| I6I08_RS06915 | 1667995..1668492 | - | 498 | WP_141407137.1 | RecX family transcriptional regulator | - |
| I6I08_RS06920 | 1668492..1669733 | - | 1242 | WP_075378254.1 | recombinase RecA | - |
| I6I08_RS06925 | 1670001..1670264 | - | 264 | WP_178389355.1 | DUF3046 domain-containing protein | - |
| I6I08_RS06930 | 1670349..1670759 | - | 411 | WP_004565236.1 | helix-turn-helix domain-containing protein | - |
| I6I08_RS06935 | 1670921..1671442 | - | 522 | WP_141407138.1 | CinA family protein | - |
| I6I08_RS06940 | 1671459..1672082 | - | 624 | WP_141407139.1 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase | - |
| I6I08_RS06945 | 1672321..1673664 | + | 1344 | WP_141407140.1 | CapA family protein | - |
| I6I08_RS06950 | 1673653..1676556 | - | 2904 | WP_141407141.1 | DNA translocase FtsK | - |
| I6I08_RS06955 | 1676703..1677638 | - | 936 | WP_075378257.1 | ribokinase | - |
| I6I08_RS06960 | 1677657..1679291 | - | 1635 | WP_043537763.1 | ribonuclease J | - |
| I6I08_RS06965 | 1679471..1680307 | + | 837 | WP_141407142.1 | polysaccharide deacetylase family protein | - |
| I6I08_RS06990 | 1681798..1682553 | + | 756 | WP_020991603.1 | hypothetical protein | - |
| I6I08_RS06995 | 1682692..1684308 | - | 1617 | WP_141407143.1 | glutamate--tRNA ligase | - |
| I6I08_RS07000 | 1684760..1685563 | + | 804 | WP_141407144.1 | hypothetical protein | - |
| I6I08_RS07005 | 1685714..1686538 | - | 825 | WP_070509962.1 | fumarylacetoacetate hydrolase family protein | - |
| I6I08_RS07010 | 1686564..1688159 | - | 1596 | WP_141407145.1 | alanine:cation symporter family protein | - |
| I6I08_RS07015 | 1688400..1689869 | - | 1470 | WP_141407146.1 | alanine:cation symporter family protein | - |
| I6I08_RS07020 | 1689875..1691329 | - | 1455 | WP_141407147.1 | alanine:cation symporter family protein | - |
| I6I08_RS07025 | 1691326..1692873 | - | 1548 | WP_141407148.1 | sodium:alanine symporter family protein | - |
| I6I08_RS07030 | 1692997..1694193 | - | 1197 | WP_141407149.1 | DUF4241 domain-containing protein | - |
| I6I08_RS07035 | 1694312..1696099 | - | 1788 | WP_070509951.1 | oleate hydratase | - |
| I6I08_RS07040 | 1696252..1698942 | + | 2691 | WP_141407150.1 | DEAD/DEAH box helicase | - |
| I6I08_RS07045 | 1698939..1699574 | - | 636 | WP_141407151.1 | GyrI-like domain-containing protein | - |
| I6I08_RS07050 | 1699564..1700082 | - | 519 | WP_141407152.1 | helix-turn-helix transcriptional regulator | - |
| I6I08_RS07055 | 1700167..1701144 | - | 978 | WP_141407153.1 | homocysteine S-methyltransferase | - |
| I6I08_RS07060 | 1701335..1702675 | + | 1341 | WP_141407154.1 | amino acid permease | - |
| I6I08_RS07065 | 1702705..1703079 | - | 375 | WP_141407155.1 | YccF domain-containing protein | - |
| I6I08_RS07070 | 1703130..1704050 | - | 921 | WP_004565259.1 | glutathione synthetase | - |
| I6I08_RS07075 | 1704232..1704744 | + | 513 | WP_141407156.1 | hypothetical protein | - |
| I6I08_RS07090 | 1705399..1705623 | + | 225 | WP_198498090.1 | hypothetical protein | - |
| I6I08_RS07095 | 1705779..1706255 | + | 477 | WP_141407157.1 | thioredoxin-dependent thiol peroxidase | - |
| I6I08_RS07105 | 1706524..1707876 | + | 1353 | WP_141407158.1 | SMI1/KNR4 family protein | - |
| I6I08_RS07110 | 1707955..1708563 | - | 609 | WP_020991608.1 | hypothetical protein | - |
| I6I08_RS07115 | 1708769..1709062 | - | 294 | WP_004565265.1 | antibiotic biosynthesis monooxygenase | - |
| I6I08_RS07120 | 1709216..1710022 | + | 807 | WP_141407159.1 | ribonuclease PH | - |
| I6I08_RS07125 | 1710026..1710730 | + | 705 | WP_141407160.1 | RdgB/HAM1 family non-canonical purine NTP pyrophosphatase | - |
| I6I08_RS07130 | 1710761..1712203 | - | 1443 | WP_141407161.1 | L,D-transpeptidase | - |
| I6I08_RS07135 | 1712290..1712703 | - | 414 | WP_141407205.1 | DUF3054 domain-containing protein | - |
| I6I08_RS07140 | 1712817..1713614 | - | 798 | WP_004565270.1 | MBL fold metallo-hydrolase | - |
| I6I08_RS07145 | 1713611..1714495 | - | 885 | WP_004565271.1 | glutamate racemase | - |
| I6I08_RS07150 | 1714505..1715191 | - | 687 | WP_141407162.1 | DUF2017 family protein | - |
| I6I08_RS07155 | 1715191..1715526 | - | 336 | WP_075379565.1 | ATP-dependent Clp protease adapter ClpS | - |
| I6I08_RS07160 | 1715607..1716977 | + | 1371 | WP_141407206.1 | nicotinate phosphoribosyltransferase | - |
| I6I08_RS07165 | 1717089..1718912 | - | 1824 | WP_075379566.1 | DEAD/DEAH box helicase | - |
| I6I08_RS07170 | 1718909..1719274 | - | 366 | WP_075379567.1 | DUF3039 domain-containing protein | - |
| I6I08_RS07175 | 1719366..1720106 | - | 741 | WP_065361579.1 | glucosamine-6-phosphate deaminase | - |
| I6I08_RS07180 | 1720247..1721971 | - | 1725 | WP_075379568.1 | transporter | - |
| I6I08_RS07185 | 1721947..1722792 | - | 846 | WP_029316630.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS07190 | 1722997..1723278 | - | 282 | WP_003783064.1 | HU family DNA-binding protein | - |
| I6I08_RS07195 | 1723481..1724230 | - | 750 | WP_198498091.1 | N-acetylmannosamine-6-phosphate 2-epimerase | - |
| I6I08_RS07200 | 1724267..1725307 | - | 1041 | WP_141407163.1 | ROK family protein | - |
| I6I08_RS07205 | 1725477..1726397 | - | 921 | WP_141407164.1 | dihydrodipicolinate synthase family protein | - |
| I6I08_RS07210 | 1726595..1727422 | - | 828 | WP_075379571.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS07215 | 1727422..1729572 | - | 2151 | WP_141407165.1 | dipeptide/oligopeptide/nickel ABC transporter permease/ATP-binding protein | - |
| I6I08_RS07220 | 1729572..1730537 | - | 966 | WP_004565289.1 | ABC transporter permease | - |
| I6I08_RS07225 | 1730746..1732371 | - | 1626 | WP_141407166.1 | ABC transporter substrate-binding protein | - |
| I6I08_RS07230 | 1732542..1733384 | + | 843 | WP_198498092.1 | GntR family transcriptional regulator | - |
| I6I08_RS07235 | 1733381..1734469 | - | 1089 | WP_141407501.1 | alpha/beta hydrolase | - |
| I6I08_RS07240 | 1734685..1735404 | + | 720 | WP_198498093.1 | GntR family transcriptional regulator | - |
| I6I08_RS07250 | 1736105..1736641 | - | 537 | WP_009747496.1 | SsrA-binding protein SmpB | - |
| I6I08_RS07255 | 1736797..1738113 | - | 1317 | WP_004565298.1 | peptidoglycan DD-metalloendopeptidase family protein | - |
| I6I08_RS07260 | 1738120..1739037 | - | 918 | WP_010614826.1 | permease-like cell division protein FtsX | - |
| I6I08_RS07265 | 1739050..1739739 | - | 690 | WP_004565300.1 | cell division ATP-binding protein FtsE | - |
| I6I08_RS07270 | 1739955..1740515 | + | 561 | WP_075379381.1 | hypothetical protein | - |
| I6I08_RS07275 | 1740508..1741230 | - | 723 | WP_075379382.1 | single-stranded DNA-binding protein | - |
| I6I08_RS07280 | 1741398..1742900 | - | 1503 | WP_141407419.1 | 50S ribosome-binding GTPase | - |
| I6I08_RS07285 | 1742897..1744498 | - | 1602 | WP_075379384.1 | ABC transporter | - |
| I6I08_RS07295 | 1745275..1747962 | + | 2688 | WP_075379385.1 | ATP-binding cassette domain-containing protein | - |
| I6I08_RS07300 | 1748050..1750557 | - | 2508 | WP_141407420.1 | serine/threonine protein kinase | - |
| I6I08_RS07305 | 1750741..1751352 | + | 612 | WP_141407441.1 | oligoribonuclease | - |
| I6I08_RS07315 | 1751755..1752615 | + | 861 | WP_141407421.1 | polysaccharide deacetylase family protein | - |
| I6I08_RS07320 | 1752622..1753029 | - | 408 | WP_141407422.1 | glycerol-3-phosphate cytidylyltransferase | - |
| I6I08_RS07325 | 1753984..1755024 | + | 1041 | WP_141407423.1 | glycosyltransferase family 4 protein | - |
| I6I08_RS07330 | 1755029..1756303 | + | 1275 | WP_075379391.1 | glycosyltransferase family 4 protein | - |
| I6I08_RS07335 | 1756296..1758023 | + | 1728 | WP_141407424.1 | glycosyltransferase family 4 protein | - |
| I6I08_RS07340 | 1758020..1758934 | + | 915 | WP_141407425.1 | ABC transporter permease | - |
| I6I08_RS07345 | 1758921..1759958 | + | 1038 | WP_141407426.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS07350 | 1759961..1760737 | + | 777 | WP_075374709.1 | hypothetical protein | - |
| I6I08_RS07355 | 1760789..1762003 | - | 1215 | WP_141407427.1 | glycosyltransferase family 2 protein | - |
| I6I08_RS07360 | 1762032..1764437 | - | 2406 | WP_141407428.1 | hypothetical protein | - |
| I6I08_RS07365 | 1764434..1766371 | - | 1938 | WP_198498094.1 | glycosyltransferase | - |
| I6I08_RS07370 | 1766356..1768200 | - | 1845 | WP_141407430.1 | glycosyltransferase family 61 protein | - |
| I6I08_RS07375 | 1768197..1772186 | - | 3990 | WP_141407431.1 | CDP-glycerol glycerophosphotransferase family protein | - |
| I6I08_RS07380 | 1772327..1772719 | - | 393 | WP_065363115.1 | glycerol-3-phosphate cytidylyltransferase | - |
| I6I08_RS07385 | 1772984..1776193 | - | 3210 | WP_141407432.1 | CDP-glycerol glycerophosphotransferase family protein | - |
| I6I08_RS07390 | 1776175..1777482 | - | 1308 | WP_075379399.1 | UDP-N-acetyl-D-mannosamine dehydrogenase | - |
| I6I08_RS07395 | 1777558..1778694 | - | 1137 | WP_141407433.1 | LCP family protein | - |
| I6I08_RS07400 | 1778874..1780049 | - | 1176 | WP_004565326.1 | branched-chain amino acid aminotransferase | - |
| I6I08_RS07405 | 1780136..1780963 | + | 828 | WP_141407434.1 | gametogenetin | - |
| I6I08_RS07410 | 1780998..1781657 | - | 660 | WP_141407435.1 | hypothetical protein | - |
| I6I08_RS07415 | 1781725..1782792 | - | 1068 | WP_141407436.1 | 3-isopropylmalate dehydrogenase | - |
| I6I08_RS07420 | 1782909..1783529 | + | 621 | WP_141407437.1 | TetR/AcrR family transcriptional regulator | - |
| I6I08_RS07425 | 1783526..1784785 | + | 1260 | WP_141407438.1 | MFS transporter | - |
| I6I08_RS07430 | 1784865..1785896 | - | 1032 | WP_075373901.1 | ketol-acid reductoisomerase | - |
| I6I08_RS07435 | 1785906..1786418 | - | 513 | WP_003784785.1 | acetolactate synthase small subunit | - |
| I6I08_RS07440 | 1786424..1788208 | - | 1785 | WP_141407439.1 | acetolactate synthase large subunit | - |
| I6I08_RS07445 | 1788508..1790280 | + | 1773 | WP_198498095.1 | transporter | - |
| I6I08_RS07450 | 1790386..1791771 | - | 1386 | WP_141407440.1 | threonine/serine exporter family protein | - |
| I6I08_RS07470 | 1798098..1798655 | + | 558 | WP_075415520.1 | DoxX family protein | - |
| I6I08_RS07475 | 1798776..1800164 | - | 1389 | WP_141407409.1 | NAD-dependent malic enzyme | - |
| I6I08_RS07480 | 1800491..1801987 | - | 1497 | WP_141407408.1 | Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB | - |
| I6I08_RS07485 | 1801984..1803525 | - | 1542 | WP_141407407.1 | Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA | - |
| I6I08_RS07490 | 1803522..1803827 | - | 306 | WP_003789737.1 | Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC | - |
| I6I08_RS07495 | 1804232..1806061 | + | 1830 | WP_141407406.1 | L,D-transpeptidase | - |
| I6I08_RS07500 | 1806148..1808604 | - | 2457 | WP_141407405.1 | NAD-dependent DNA ligase LigA | - |
| I6I08_RS07505 | 1808647..1812369 | + | 3723 | WP_141407404.1 | cell division protein FtsK | - |
| I6I08_RS07510 | 1812576..1812824 | + | 249 | WP_003779481.1 | WhiB family transcriptional regulator | - |
| I6I08_RS07515 | 1812923..1814398 | - | 1476 | WP_070511887.1 | PAS domain-containing sensor histidine kinase | - |
| I6I08_RS07520 | 1814575..1815069 | + | 495 | WP_141407403.1 | DUF2505 domain-containing protein | - |
| I6I08_RS07525 | 1815234..1815674 | + | 441 | WP_060956517.1 | OsmC family protein | - |
| I6I08_RS07530 | 1815749..1816447 | + | 699 | WP_009747504.1 | hypothetical protein | - |
| I6I08_RS07535 | 1816510..1817337 | + | 828 | WP_198498171.1 | thymidylate synthase | - |
| I6I08_RS07540 | 1817334..1817924 | + | 591 | WP_141407401.1 | dihydrofolate reductase | - |
| I6I08_RS07545 | 1817965..1818372 | - | 408 | WP_141407400.1 | helix-turn-helix transcriptional regulator | - |
| I6I08_RS07550 | 1818509..1819132 | - | 624 | WP_141407399.1 | NAD(P)-binding domain-containing protein | - |
| I6I08_RS07555 | 1819291..1820301 | - | 1011 | WP_141407398.1 | ABC transporter substrate-binding protein | - |
| I6I08_RS07560 | 1820298..1820978 | - | 681 | WP_141407397.1 | ABC transporter permease | - |
| I6I08_RS07565 | 1820975..1821679 | - | 705 | WP_141407396.1 | ABC transporter permease subunit | - |
| I6I08_RS07570 | 1821676..1822545 | - | 870 | WP_141407395.1 | ATP-binding cassette domain-containing protein | - |
| I6I08_RS07575 | 1822837..1823223 | - | 387 | WP_141407418.1 | DUF1304 family protein | - |
| I6I08_RS07580 | 1823327..1825156 | - | 1830 | WP_141407394.1 | esterase | - |
| I6I08_RS07585 | 1825388..1826824 | - | 1437 | WP_070511858.1 | class II fumarate hydratase | - |
| I6I08_RS07590 | 1826920..1827513 | - | 594 | WP_075377737.1 | TetR/AcrR family transcriptional regulator | - |
| I6I08_RS07595 | 1827598..1827978 | + | 381 | WP_020991835.1 | nuclear transport factor 2 family protein | - |
| I6I08_RS07600 | 1828018..1828902 | - | 885 | WP_141407393.1 | purine-nucleoside phosphorylase | - |
| I6I08_RS07605 | 1828899..1830347 | - | 1449 | WP_141407392.1 | cytosine permease | - |
| I6I08_RS07610 | 1830611..1830799 | + | 189 | WP_020991836.1 | CsbD family protein | - |
| I6I08_RS07615 | 1830874..1832085 | - | 1212 | WP_141407391.1 | hypothetical protein | - |
| I6I08_RS07620 | 1832124..1832774 | - | 651 | WP_003789699.1 | hypothetical protein | - |
| I6I08_RS07625 | 1832942..1833622 | - | 681 | WP_198498172.1 | tRNA 2-methylthio-N6-isopentenyl adenosine(37) hydroxylase MiaE-like protein | - |
| I6I08_RS07630 | 1833887..1835566 | + | 1680 | WP_141407389.1 | DEAD/DEAH box helicase | - |
| I6I08_RS07635 | 1835634..1836263 | - | 630 | WP_070511836.1 | MarC family protein | - |
| I6I08_RS07640 | 1836320..1837165 | - | 846 | WP_141407388.1 | PHP domain-containing protein | - |
| I6I08_RS07645 | 1837223..1838323 | + | 1101 | WP_141407387.1 | Gfo/Idh/MocA family oxidoreductase | - |
| I6I08_RS07650 | 1838388..1840013 | + | 1626 | WP_141407386.1 | aminopeptidase P N-terminal domain-containing protein | - |
| I6I08_RS07655 | 1840078..1840449 | + | 372 | WP_070511825.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| I6I08_RS07660 | 1840446..1841420 | + | 975 | WP_141407385.1 | cation diffusion facilitator family transporter | - |
| I6I08_RS07665 | 1841427..1842275 | - | 849 | WP_070511819.1 | sugar phosphate isomerase/epimerase | - |
| I6I08_RS07670 | 1842305..1843111 | - | 807 | WP_141407384.1 | hypothetical protein | - |
| I6I08_RS07675 | 1843192..1844484 | + | 1293 | WP_075377748.1 | magnesium transporter | - |
| I6I08_RS07680 | 1844477..1845049 | + | 573 | WP_141407383.1 | DUF1003 domain-containing protein | - |
| I6I08_RS07685 | 1845119..1846261 | + | 1143 | WP_075375215.1 | Mrp/NBP35 family ATP-binding protein | - |
| I6I08_RS07690 | 1846355..1847299 | - | 945 | WP_141407382.1 | twin-arginine translocase TatA/TatE family subunit | - |
| I6I08_RS07695 | 1847459..1848094 | + | 636 | WP_009406302.1 | O-methyltransferase | - |
| I6I08_RS07700 | 1848243..1848410 | - | 168 | WP_009396029.1 | DUF3117 domain-containing protein | - |
| I6I08_RS07705 | 1848516..1849271 | - | 756 | WP_070511805.1 | TIGR00730 family Rossman fold protein | - |
| I6I08_RS07710 | 1849572..1851311 | + | 1740 | WP_075375217.1 | phospho-sugar mutase | - |
| I6I08_RS07715 | 1851379..1852269 | - | 891 | WP_141407381.1 | metal ABC transporter permease | - |
| I6I08_RS07720 | 1852266..1853285 | - | 1020 | WP_141407380.1 | metal ABC transporter permease | - |
| I6I08_RS07725 | 1853282..1854100 | - | 819 | WP_141407379.1 | metal ABC transporter ATP-binding protein | - |
| I6I08_RS07730 | 1854109..1855311 | - | 1203 | WP_141407378.1 | metal ABC transporter substrate-binding protein | - |
| I6I08_RS07735 | 1855458..1856111 | - | 654 | WP_075377758.1 | deoxyribose-phosphate aldolase | - |
| I6I08_RS07740 | 1856467..1857270 | - | 804 | WP_141407376.1 | hypothetical protein | - |
| I6I08_RS07745 | 1857267..1858625 | - | 1359 | WP_141407375.1 | thymidine phosphorylase | - |
| I6I08_RS07750 | 1858650..1859084 | - | 435 | WP_003789641.1 | cytidine deaminase | - |
| I6I08_RS07755 | 1859081..1860373 | - | 1293 | WP_141407374.1 | ABC transporter permease | - |
| I6I08_RS07760 | 1860377..1861696 | - | 1320 | WP_141407373.1 | ABC transporter permease | - |
| I6I08_RS07765 | 1861693..1863222 | - | 1530 | WP_141407372.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS07770 | 1863280..1864380 | - | 1101 | WP_141407371.1 | BMP family ABC transporter substrate-binding protein | - |
| I6I08_RS07775 | 1865173..1866414 | - | 1242 | WP_141407369.1 | mannose-1-phosphate guanylyltransferase | - |
| I6I08_RS07780 | 1866481..1867503 | - | 1023 | WP_075377767.1 | YihY/virulence factor BrkB family protein | - |
| I6I08_RS07785 | 1867500..1868162 | - | 663 | WP_141407368.1 | 2'-5' RNA ligase family protein | - |
| I6I08_RS07790 | 1868480..1869277 | + | 798 | WP_141407417.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| I6I08_RS07795 | 1869349..1870626 | + | 1278 | WP_141407367.1 | galactokinase | - |
| I6I08_RS07800 | 1870806..1871873 | + | 1068 | WP_141407366.1 | biotin/lipoyl-binding protein | - |
| I6I08_RS07805 | 1871870..1872661 | + | 792 | WP_141407365.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS07810 | 1872658..1874079 | + | 1422 | WP_141407364.1 | FtsX-like permease family protein | - |
| I6I08_RS07815 | 1874149..1874982 | - | 834 | WP_075377773.1 | endonuclease/exonuclease/phosphatase family protein | - |
| I6I08_RS07820 | 1875029..1875334 | + | 306 | WP_075377774.1 | acylphosphatase | - |
| I6I08_RS07825 | 1875347..1875571 | + | 225 | WP_075377775.1 | hypothetical protein | - |
| I6I08_RS07830 | 1875666..1876874 | - | 1209 | WP_075377776.1 | choice-of-anchor L domain-containing protein | - |
| I6I08_RS07835 | 1877210..1879120 | + | 1911 | WP_075377777.1 | glycoside hydrolase family 68 protein | - |
| I6I08_RS07840 | 1879217..1880959 | - | 1743 | WP_141407363.1 | glycoside hydrolase family 32 protein | - |
| I6I08_RS07845 | 1881002..1881898 | - | 897 | WP_003789598.1 | bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase | - |
| I6I08_RS07850 | 1881895..1883178 | - | 1284 | WP_198498173.1 | serine hydroxymethyltransferase | - |
| I6I08_RS07855 | 1883470..1884666 | - | 1197 | WP_141407361.1 | cobalamin biosynthesis protein CobW | - |
| I6I08_RS07860 | 1884722..1884961 | + | 240 | WP_003789593.1 | 50S ribosomal protein L28 | - |
| I6I08_RS07865 | 1884958..1885131 | + | 174 | WP_003789591.1 | 50S ribosomal protein L33 | - |
| I6I08_RS07870 | 1885131..1885436 | + | 306 | WP_141407360.1 | 30S ribosomal protein S14 | - |
| I6I08_RS07875 | 1885584..1885835 | + | 252 | WP_141407359.1 | type B 50S ribosomal protein L31 | - |
| I6I08_RS07880 | 1885916..1886038 | + | 123 | WP_003782012.1 | type B 50S ribosomal protein L36 | - |
| I6I08_RS07885 | 1886121..1886993 | + | 873 | WP_141407358.1 | formyltetrahydrofolate deformylase | - |
| I6I08_RS07890 | 1887099..1888292 | - | 1194 | WP_075377785.1 | alcohol dehydrogenase catalytic domain-containing protein | - |
| I6I08_RS07895 | 1889066..1889710 | + | 645 | Protein_1536 | hypothetical protein | - |
| I6I08_RS07900 | 1890001..1890543 | + | 543 | WP_141407416.1 | zinc transporter | - |
| I6I08_RS07905 | 1891156..1891680 | + | 525 | WP_141407357.1 | DUF664 domain-containing protein | - |
| I6I08_RS07910 | 1891800..1893035 | - | 1236 | WP_198498174.1 | amidohydrolase family protein | - |
| I6I08_RS07915 | 1893145..1894401 | - | 1257 | WP_141407355.1 | winged helix DNA-binding domain-containing protein | - |
| I6I08_RS07920 | 1894412..1895107 | - | 696 | WP_009405946.1 | endonuclease NucS | - |
| I6I08_RS07925 | 1895521..1895937 | - | 417 | WP_141407354.1 | DUF2550 domain-containing protein | - |
| I6I08_RS07930 | 1895941..1896207 | - | 267 | WP_141407353.1 | F0F1 ATP synthase subunit epsilon | - |
| I6I08_RS07935 | 1896253..1897689 | - | 1437 | WP_141407352.1 | F0F1 ATP synthase subunit beta | - |
| I6I08_RS07940 | 1897783..1898730 | - | 948 | WP_070661188.1 | F0F1 ATP synthase subunit gamma | - |
| I6I08_RS07945 | 1898732..1900363 | - | 1632 | WP_003789538.1 | F0F1 ATP synthase subunit alpha | - |
| I6I08_RS07950 | 1900468..1901283 | - | 816 | WP_003789535.1 | F0F1 ATP synthase subunit delta | - |
| I6I08_RS07955 | 1901280..1901861 | - | 582 | WP_020991854.1 | F0F1 ATP synthase subunit B | - |
| I6I08_RS07960 | 1901861..1902070 | - | 210 | WP_003785325.1 | ATP synthase F0 subunit C | - |
| I6I08_RS07965 | 1902150..1903019 | - | 870 | WP_003789532.1 | F0F1 ATP synthase subunit A | - |
| I6I08_RS07970 | 1903237..1903731 | - | 495 | WP_170198645.1 | pseudouridine synthase | - |
| I6I08_RS07975 | 1903755..1905020 | - | 1266 | WP_003789528.1 | undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase | - |
| I6I08_RS07980 | 1905017..1905787 | - | 771 | WP_040321533.1 | threonylcarbamoyl-AMP synthase | - |
| I6I08_RS07985 | 1905925..1906638 | - | 714 | WP_003789524.1 | response regulator transcription factor | - |
| I6I08_RS07990 | 1906722..1907927 | - | 1206 | WP_141407415.1 | ATP-binding protein | - |
| I6I08_RS07995 | 1908215..1910287 | + | 2073 | WP_141407351.1 | PspC domain-containing protein | - |
| I6I08_RS08000 | 1910362..1910844 | + | 483 | WP_075377803.1 | hypothetical protein | - |
| I6I08_RS08005 | 1911021..1911392 | + | 372 | WP_075377804.1 | SdpI family protein | - |
| I6I08_RS08010 | 1911472..1912065 | - | 594 | WP_075377805.1 | DJ-1/PfpI family protein | - |
| I6I08_RS08015 | 1912252..1913082 | + | 831 | WP_075377806.1 | HAMP domain-containing histidine kinase | - |
| I6I08_RS08020 | 1913144..1913842 | + | 699 | WP_081379291.1 | response regulator transcription factor | - |
| I6I08_RS08025 | 1913978..1915012 | + | 1035 | WP_141407350.1 | ABC transporter substrate-binding protein | - |
| I6I08_RS08030 | 1915119..1916870 | + | 1752 | WP_141407349.1 | iron ABC transporter permease | - |
| I6I08_RS08035 | 1916895..1918067 | + | 1173 | WP_075377809.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS08040 | 1918129..1919661 | - | 1533 | WP_141407348.1 | alpha-amylase | - |
| I6I08_RS08045 | 1920487..1921602 | - | 1116 | WP_141407347.1 | restriction endonuclease | - |
| I6I08_RS08050 | 1921599..1923578 | - | 1980 | WP_198498096.1 | AAA family ATPase | - |
| I6I08_RS08055 | 1923954..1924157 | + | 204 | WP_075377812.1 | CopG family transcriptional regulator | - |
| I6I08_RS08060 | 1924126..1924545 | + | 420 | WP_141407345.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
| I6I08_RS08065 | 1924851..1925660 | - | 810 | WP_141407344.1 | class I SAM-dependent methyltransferase | - |
| I6I08_RS08070 | 1925750..1926589 | - | 840 | WP_075379450.1 | alpha/beta fold hydrolase | - |
| I6I08_RS08075 | 1926627..1927406 | - | 780 | WP_141407343.1 | carboxymuconolactone decarboxylase family protein | - |
| I6I08_RS08080 | 1927504..1927821 | - | 318 | WP_075379452.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| I6I08_RS08085 | 1927811..1928080 | - | 270 | WP_075374854.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| I6I08_RS08090 | 1928129..1930642 | - | 2514 | WP_198498097.1 | glycoside hydrolase family 3 protein | - |
| I6I08_RS08095 | 1930818..1931821 | + | 1004 | Protein_1576 | alpha/beta hydrolase | - |
| I6I08_RS08100 | 1931888..1933150 | - | 1263 | WP_141407342.1 | ATP-binding protein | - |
| I6I08_RS08105 | 1933368..1934048 | - | 681 | WP_075379455.1 | response regulator transcription factor | - |
| I6I08_RS08110 | 1934045..1935181 | - | 1137 | WP_141407341.1 | two-component sensor histidine kinase | - |
| I6I08_RS08115 | 1935375..1936358 | + | 984 | WP_075379457.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS08120 | 1936360..1937502 | + | 1143 | WP_141407340.1 | ABC transporter permease | - |
| I6I08_RS08125 | 1937519..1938673 | + | 1155 | WP_141407413.1 | ABC transporter permease | - |
| I6I08_RS08130 | 1938774..1939640 | - | 867 | WP_075379460.1 | hypothetical protein | - |
| I6I08_RS08135 | 1940091..1941107 | - | 1017 | WP_141407412.1 | hypothetical protein | - |
| I6I08_RS08140 | 1941628..1943214 | - | 1587 | WP_075379461.1 | glutamine-hydrolyzing GMP synthase | - |
| I6I08_RS08145 | 1943664..1943936 | + | 273 | WP_075379462.1 | hypothetical protein | - |
| I6I08_RS08150 | 1944485..1945651 | - | 1167 | WP_075379463.1 | zinc-binding dehydrogenase | - |
| I6I08_RS08155 | 1945808..1947088 | - | 1281 | WP_141407339.1 | MFS transporter | - |
| I6I08_RS08160 | 1947275..1948891 | - | 1617 | WP_141407338.1 | MFS transporter | - |
| I6I08_RS08165 | 1949413..1950906 | - | 1494 | WP_075379466.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
| I6I08_RS08170 | 1951276..1953183 | - | 1908 | WP_141407337.1 | 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (decyclizing) | - |
| I6I08_RS08175 | 1953238..1954152 | - | 915 | WP_141407336.1 | 5-deoxy-glucuronate isomerase | - |
| I6I08_RS08180 | 1954297..1955211 | - | 915 | WP_141407335.1 | deoxyribose-phosphate aldolase | - |
| I6I08_RS08185 | 1955222..1956274 | - | 1053 | WP_075379470.1 | 5-dehydro-2-deoxygluconokinase | - |
| I6I08_RS08190 | 1956463..1957254 | + | 792 | WP_178389508.1 | GntR family transcriptional regulator | - |
| I6I08_RS08195 | 1957408..1958484 | + | 1077 | WP_070512168.1 | transaldolase family protein | - |
| I6I08_RS08200 | 1958675..1959664 | + | 990 | WP_070512171.1 | inositol 2-dehydrogenase | - |
| I6I08_RS08205 | 1959779..1960741 | - | 963 | WP_075379473.1 | aldose-1-epimerase | - |
| I6I08_RS08210 | 1960821..1961900 | - | 1080 | WP_141407334.1 | LacI family transcriptional regulator | - |
| I6I08_RS08215 | 1962181..1963377 | + | 1197 | WP_075379474.1 | Gfo/Idh/MocA family oxidoreductase | - |
| I6I08_RS08220 | 1963472..1965127 | + | 1656 | WP_070512177.1 | MFS transporter | - |
| I6I08_RS08225 | 1965361..1966287 | + | 927 | WP_075379475.1 | myo-inosose-2 dehydratase | - |
| I6I08_RS08230 | 1966528..1967001 | + | 474 | WP_141407333.1 | pre-mRNA-splicing factor | - |
| I6I08_RS08235 | 1967134..1967907 | + | 774 | WP_075379477.1 | sulfite exporter TauE/SafE family protein | - |
| I6I08_RS08240 | 1968086..1968487 | + | 402 | WP_075379478.1 | hypothetical protein | - |
| I6I08_RS08245 | 1968509..1969555 | + | 1047 | WP_141407411.1 | PepSY domain-containing protein | - |
| I6I08_RS08250 | 1969729..1971783 | + | 2055 | WP_009405611.1 | phosphate acetyltransferase | - |
| I6I08_RS08255 | 1971901..1973085 | + | 1185 | WP_141407332.1 | acetate kinase | - |
| I6I08_RS08260 | 1973492..1974421 | + | 930 | WP_141407410.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS08265 | 1974418..1975329 | + | 912 | WP_141407331.1 | ABC transporter permease | - |
| I6I08_RS08270 | 1975326..1976219 | + | 894 | WP_141407330.1 | ABC transporter permease | - |
| I6I08_RS08275 | 1976216..1977538 | + | 1323 | WP_141407329.1 | two-component sensor histidine kinase | - |
| I6I08_RS08280 | 1977535..1978260 | + | 726 | WP_198498098.1 | response regulator transcription factor | - |
| I6I08_RS08285 | 1978278..1978760 | - | 483 | WP_141407328.1 | GtrA family protein | - |
| I6I08_RS08290 | 1978871..1979437 | - | 567 | WP_141407327.1 | ribonuclease HI | - |
| I6I08_RS08295 | 1979668..1981410 | + | 1743 | WP_141407326.1 | sodium:solute symporter family protein | - |
| I6I08_RS08300 | 1981441..1981665 | + | 225 | WP_141407325.1 | hypothetical protein | - |
| I6I08_RS08305 | 1981894..1983000 | + | 1107 | Protein_1618 | IS1634 family transposase | - |
| I6I08_RS08310 | 1983148..1984446 | + | 1299 | WP_141407443.1 | low temperature requirement protein A | - |
| I6I08_RS08315 | 1984568..1984921 | - | 354 | Protein_1620 | hypothetical protein | - |
| I6I08_RS08320 | 1985017..1986166 | + | 1150 | Protein_1621 | IS1634 family transposase | - |
| I6I08_RS08325 | 1986211..1987104 | - | 894 | WP_075378910.1 | multidrug DMT transporter permease | - |
| I6I08_RS08330 | 1987206..1987472 | - | 267 | WP_010614584.1 | HPr family phosphocarrier protein | - |
| I6I08_RS08335 | 1987639..1988763 | - | 1125 | WP_060956634.1 | GuaB3 family IMP dehydrogenase-related protein | - |
| I6I08_RS08340 | 1988900..1989682 | + | 783 | WP_141406368.1 | DNA polymerase III subunit epsilon | - |
| I6I08_RS08345 | 1989815..1991377 | - | 1563 | WP_198498099.1 | IMP dehydrogenase | - |
| I6I08_RS08350 | 1991817..1992119 | + | 303 | WP_075378908.1 | WhiB family transcriptional regulator | - |
| I6I08_RS08355 | 1992301..1992597 | - | 297 | WP_003789398.1 | co-chaperone GroES | - |
| I6I08_RS08360 | 1992848..1993498 | - | 651 | WP_075378907.1 | YdcF family protein | - |
| I6I08_RS08365 | 1993856..1995127 | + | 1272 | WP_141406370.1 | class I SAM-dependent methyltransferase | - |
| I6I08_RS08370 | 1995204..1996436 | + | 1233 | WP_003789393.1 | glutamate--cysteine ligase | - |
| I6I08_RS08375 | 1997165..2001049 | - | 3885 | WP_141406371.1 | ABC transporter ATP-binding protein/permease | - |
| I6I08_RS08380 | 2001170..2001892 | + | 723 | WP_141406372.1 | TetR/AcrR family transcriptional regulator | - |
| I6I08_RS08385 | 2001876..2002922 | - | 1047 | WP_141406373.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD | - |
| I6I08_RS08390 | 2002980..2003336 | + | 357 | Protein_1635 | HAD-IA family hydrolase | - |
| I6I08_RS08395 | 2003635..2004405 | - | 771 | WP_003785183.1 | succinate dehydrogenase/fumarate reductase iron-sulfur subunit | - |
| I6I08_RS08400 | 2004402..2006402 | - | 2001 | WP_141406374.1 | fumarate reductase/succinate dehydrogenase flavoprotein subunit | - |
| I6I08_RS08405 | 2006415..2007167 | - | 753 | WP_178389488.1 | succinate dehydrogenase cytochrome b subunit | - |
| I6I08_RS08410 | 2007556..2008161 | - | 606 | WP_141406375.1 | GNAT family N-acetyltransferase | - |
| I6I08_RS08415 | 2008187..2008945 | - | 759 | WP_141406376.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB | - |
| I6I08_RS08420 | 2008955..2010004 | - | 1050 | WP_141406377.1 | hypothetical protein | - |
| I6I08_RS08425 | 2010001..2010639 | - | 639 | WP_141406378.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE | - |
| I6I08_RS08430 | 2010720..2012036 | - | 1317 | WP_141406401.1 | alanine racemase | - |
| I6I08_RS08435 | 2012158..2014068 | - | 1911 | WP_141406379.1 | bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase | - |
| I6I08_RS08440 | 2014266..2014745 | + | 480 | WP_141406380.1 | holo-ACP synthase | - |
| I6I08_RS08445 | 2014827..2016731 | - | 1905 | WP_141406381.1 | glutamine--fructose-6-phosphate transaminase (isomerizing) | - |
| I6I08_RS08450 | 2016904..2017887 | + | 984 | WP_141406382.1 | type I pantothenate kinase | - |
| I6I08_RS08455 | 2018421..2019533 | - | 1113 | WP_198498100.1 | alpha/beta hydrolase | - |
| I6I08_RS08460 | 2019514..2019954 | - | 441 | WP_141406383.1 | helix-turn-helix domain-containing protein | - |
| I6I08_RS08465 | 2020264..2021271 | + | 1008 | WP_070511627.1 | 2-dehydropantoate 2-reductase | - |
| I6I08_RS08470 | 2021330..2022400 | + | 1071 | WP_141406384.1 | ATP-binding cassette domain-containing protein | - |
| I6I08_RS08475 | 2022397..2023230 | + | 834 | WP_141406385.1 | ABC transporter permease | - |
| I6I08_RS08480 | 2023247..2026444 | - | 3198 | WP_141406386.1 | winged helix-turn-helix domain-containing protein | - |
| I6I08_RS08485 | 2026543..2027004 | - | 462 | WP_141406387.1 | hypothetical protein | - |
| I6I08_RS08490 | 2027614..2028975 | - | 1362 | WP_141406388.1 | phosphoglucosamine mutase | - |
| I6I08_RS08495 | 2029287..2029781 | - | 495 | WP_141406389.1 | 30S ribosomal protein S9 | - |
| I6I08_RS08500 | 2029825..2030268 | - | 444 | WP_003789346.1 | 50S ribosomal protein L13 | - |
| I6I08_RS08505 | 2030527..2031414 | - | 888 | WP_141406390.1 | tRNA pseudouridine(38-40) synthase TruA | - |
| I6I08_RS08510 | 2031463..2032218 | + | 756 | WP_075375122.1 | ROK family protein | - |
| I6I08_RS08515 | 2032407..2033957 | + | 1551 | WP_141406391.1 | Re/Si-specific NAD(P)(+) transhydrogenase subunit alpha | - |
| I6I08_RS08520 | 2033970..2035448 | + | 1479 | WP_141406392.1 | NAD(P)(+) transhydrogenase (Re/Si-specific) subunit beta | - |
| I6I08_RS08525 | 2035461..2036189 | - | 729 | WP_141406393.1 | MgtC/SapB family protein | - |
| I6I08_RS08530 | 2036358..2038196 | + | 1839 | WP_198498101.1 | tetratricopeptide repeat protein | - |
| I6I08_RS08535 | 2038643..2039368 | - | 726 | WP_141406395.1 | 50S ribosomal protein L17 | - |
| I6I08_RS08540 | 2039399..2040400 | - | 1002 | WP_003789324.1 | DNA-directed RNA polymerase subunit alpha | - |
| I6I08_RS08545 | 2040559..2040960 | - | 402 | WP_003781888.1 | 30S ribosomal protein S11 | - |
| I6I08_RS08550 | 2041023..2041397 | - | 375 | WP_010614542.1 | 30S ribosomal protein S13 | - |
| I6I08_RS08555 | 2041563..2041676 | - | 114 | WP_003781903.1 | 50S ribosomal protein L36 | - |
| I6I08_RS08560 | 2041710..2041931 | - | 222 | WP_003781847.1 | translation initiation factor IF-1 | - |
| I6I08_RS08565 | 2042219..2043100 | - | 882 | WP_075378882.1 | type I methionyl aminopeptidase | - |
| I6I08_RS08570 | 2043236..2043823 | - | 588 | WP_198498102.1 | adenylate kinase | - |
| I6I08_RS08575 | 2043820..2045121 | - | 1302 | WP_070511607.1 | preprotein translocase subunit SecY | - |
| I6I08_RS08580 | 2045475..2045951 | - | 477 | WP_003789315.1 | 50S ribosomal protein L15 | - |
| I6I08_RS08585 | 2045953..2046159 | - | 207 | WP_009396392.1 | 50S ribosomal protein L30 | - |
| I6I08_RS08590 | 2046159..2046866 | - | 708 | WP_003789310.1 | 30S ribosomal protein S5 | - |
| I6I08_RS08595 | 2046901..2047281 | - | 381 | WP_003789309.1 | 50S ribosomal protein L18 | - |
| I6I08_RS08600 | 2047284..2047823 | - | 540 | WP_003789306.1 | 50S ribosomal protein L6 | - |
| I6I08_RS08605 | 2047845..2048243 | - | 399 | WP_003789305.1 | 30S ribosomal protein S8 | - |
| I6I08_RS08610 | 2048302..2048487 | - | 186 | WP_003781856.1 | type Z 30S ribosomal protein S14 | - |
| I6I08_RS08615 | 2048489..2049046 | - | 558 | WP_009396382.1 | 50S ribosomal protein L5 | - |
| I6I08_RS08620 | 2049049..2049393 | - | 345 | WP_003781892.1 | 50S ribosomal protein L24 | - |
| I6I08_RS08625 | 2049396..2049764 | - | 369 | WP_003781898.1 | 50S ribosomal protein L14 | - |
| I6I08_RS08630 | 2050343..2050636 | - | 294 | WP_003789301.1 | 30S ribosomal protein S17 | - |
| I6I08_RS08635 | 2050633..2050878 | - | 246 | WP_009403578.1 | 50S ribosomal protein L29 | - |
| I6I08_RS08640 | 2050878..2051297 | - | 420 | WP_003781881.1 | 50S ribosomal protein L16 | - |
| I6I08_RS08645 | 2051301..2052122 | - | 822 | WP_003789299.1 | 30S ribosomal protein S3 | - |
| I6I08_RS08650 | 2052122..2052499 | - | 378 | WP_003789298.1 | 50S ribosomal protein L22 | - |
| I6I08_RS08655 | 2052531..2052809 | - | 279 | WP_003786073.1 | 30S ribosomal protein S19 | - |
| I6I08_RS08660 | 2052824..2053660 | - | 837 | WP_009747234.1 | 50S ribosomal protein L2 | - |
| I6I08_RS08665 | 2053687..2053989 | - | 303 | WP_003786064.1 | 50S ribosomal protein L23 | - |
| I6I08_RS08670 | 2053986..2054630 | - | 645 | WP_009403568.1 | 50S ribosomal protein L4 | - |
| I6I08_RS08675 | 2054635..2055303 | - | 669 | WP_003789295.1 | 50S ribosomal protein L3 | - |
| I6I08_RS08680 | 2055312..2055620 | - | 309 | WP_003786051.1 | 30S ribosomal protein S10 | - |
| I6I08_RS08685 | 2055879..2057117 | - | 1239 | WP_141406396.1 | class C sortase | - |
| I6I08_RS08690 | 2057356..2058963 | - | 1608 | WP_075378878.1 | SpaH/EbpB family LPXTG-anchored major pilin | - |
| I6I08_RS08695 | 2059114..2061975 | - | 2862 | WP_141406397.1 | LPXTG cell wall anchor domain-containing protein | - |
| I6I08_RS08700 | 2062311..2063501 | - | 1191 | WP_070661478.1 | elongation factor Tu | - |
| I6I08_RS08705 | 2063702..2065843 | - | 2142 | WP_075378876.1 | elongation factor G | - |
| I6I08_RS08710 | 2065889..2066359 | - | 471 | WP_003786052.1 | 30S ribosomal protein S7 | - |
| I6I08_RS08715 | 2066359..2066733 | - | 375 | WP_003786082.1 | 30S ribosomal protein S12 | - |
| I6I08_RS08720 | 2067188..2067634 | + | 447 | WP_081379377.1 | DUF192 domain-containing protein | - |
| I6I08_RS08725 | 2067646..2068455 | + | 810 | WP_141406398.1 | A24 family peptidase | - |
| I6I08_RS08730 | 2068654..2069439 | + | 786 | WP_075378874.1 | hypothetical protein | - |
| I6I08_RS08735 | 2069436..2070155 | + | 720 | WP_075378873.1 | Flp pilus assembly protein CpaB | - |
| I6I08_RS08740 | 2070155..2071693 | + | 1539 | WP_081379376.1 | AAA family ATPase | - |
| I6I08_RS08745 | 2071768..2072109 | + | 342 | WP_170198590.1 | pilus assembly protein | - |
| I6I08_RS08750 | 2072111..2073418 | + | 1308 | WP_075378871.1 | CpaF family protein | - |
| I6I08_RS08755 | 2073415..2074341 | + | 927 | WP_075378870.1 | type II secretion system F family protein | - |
| I6I08_RS08760 | 2074343..2075233 | + | 891 | WP_075378869.1 | type II secretion system F family protein | - |
| I6I08_RS08765 | 2075601..2076467 | + | 867 | WP_170198589.1 | two-component sensor histidine kinase | - |
| I6I08_RS08770 | 2076464..2077096 | + | 633 | WP_075378868.1 | response regulator transcription factor | - |
| I6I08_RS08775 | 2077202..2077435 | + | 234 | WP_075378867.1 | hypothetical protein | - |
| I6I08_RS08780 | 2077598..2079250 | + | 1653 | WP_198498103.1 | OmpA family protein | - |
| I6I08_RS08785 | 2079259..2079942 | + | 684 | WP_075378865.1 | hypothetical protein | - |
| I6I08_RS08790 | 2080303..2081196 | + | 894 | WP_075378864.1 | hypothetical protein | - |
| I6I08_RS08795 | 2081400..2081870 | + | 471 | WP_075378863.1 | hypothetical protein | - |
| I6I08_RS08800 | 2081963..2082475 | + | 513 | WP_198498175.1 | hypothetical protein | - |
| I6I08_RS08805 | 2082472..2082990 | + | 519 | WP_075378861.1 | hypothetical protein | - |
| I6I08_RS08810 | 2083008..2083607 | - | 600 | WP_141407495.1 | OmpA family protein | - |
| I6I08_RS08815 | 2083688..2084035 | - | 348 | WP_141407496.1 | hypothetical protein | - |
| I6I08_RS08820 | 2084585..2086296 | + | 1712 | Protein_1721 | OmpA family protein | - |
| I6I08_RS08825 | 2086311..2088029 | + | 1719 | WP_141407444.1 | OmpA family protein | - |
| I6I08_RS08830 | 2088319..2089008 | - | 690 | WP_075378858.1 | 50S ribosomal protein L1 | - |
| I6I08_RS08835 | 2089107..2089538 | - | 432 | WP_003789267.1 | 50S ribosomal protein L11 | - |
| I6I08_RS08840 | 2089798..2090643 | - | 846 | WP_141407445.1 | transcription termination/antitermination protein NusG | - |
| I6I08_RS08845 | 2090779..2091015 | - | 237 | WP_003789264.1 | preprotein translocase subunit SecE | - |
| I6I08_RS08855 | 2091394..2092608 | + | 1215 | WP_141407446.1 | pyridoxal phosphate-dependent aminotransferase | - |
| I6I08_RS08860 | 2092825..2093808 | + | 984 | WP_141407490.1 | serine/arginine repetitive matrix protein 1 | - |
| I6I08_RS08865 | 2093900..2095147 | - | 1248 | WP_003789258.1 | phosphotransferase | - |
| I6I08_RS08870 | 2095521..2096474 | + | 954 | WP_141407447.1 | hypothetical protein | - |
| I6I08_RS08875 | 2096653..2097738 | + | 1086 | WP_141407448.1 | adenosine deaminase | - |
| I6I08_RS08880 | 2098047..2099351 | - | 1305 | WP_141407449.1 | UDP-N-acetylmuramate dehydrogenase | - |
| I6I08_RS08885 | 2099455..2099553 | - | 99 | WP_003792170.1 | AURKAIP1/COX24 domain-containing protein | - |
| I6I08_RS08890 | 2099700..2099942 | - | 243 | WP_003789249.1 | helix-turn-helix domain-containing protein | - |
| I6I08_RS08895 | 2100219..2101841 | + | 1623 | WP_141407450.1 | TrkH family potassium uptake protein | - |
| I6I08_RS08900 | 2101919..2102587 | - | 669 | WP_141407451.1 | TetR/AcrR family transcriptional regulator | - |
| I6I08_RS08905 | 2102710..2104311 | + | 1602 | WP_141407452.1 | MFS transporter | - |
| I6I08_RS08910 | 2104352..2105020 | + | 669 | WP_141407453.1 | TrkA family potassium uptake protein | - |
| I6I08_RS08915 | 2105082..2105507 | - | 426 | WP_141407454.1 | dihydroxyacetone kinase | - |
| I6I08_RS08920 | 2105504..2106163 | - | 660 | WP_141407455.1 | dihydroxyacetone kinase subunit L | - |
| I6I08_RS08925 | 2106231..2107247 | - | 1017 | WP_141407456.1 | dihydroxyacetone kinase subunit DhaK | - |
| I6I08_RS08930 | 2109224..2109736 | + | 513 | WP_075378916.1 | DNA polymerase III subunit gamma/tau | - |
| I6I08_RS08935 | 2109843..2110346 | + | 504 | WP_075378850.1 | nodulation protein NfeD | - |
| I6I08_RS08940 | 2110446..2111906 | + | 1461 | WP_141407457.1 | flotillin family protein | - |
| I6I08_RS08945 | 2111991..2113415 | + | 1425 | WP_141407458.1 | hypothetical protein | - |
| I6I08_RS08950 | 2113453..2114835 | - | 1383 | WP_141407459.1 | MFS transporter | - |
| I6I08_RS08955 | 2115048..2117138 | + | 2091 | WP_170198647.1 | transketolase | - |
| I6I08_RS08960 | 2117371..2117937 | + | 567 | WP_141407461.1 | hypothetical protein | - |
| I6I08_RS08965 | 2118001..2119422 | + | 1422 | WP_141407462.1 | DNA repair protein RadA | - |
| I6I08_RS08970 | 2119753..2120823 | + | 1071 | WP_101559851.1 | DNA integrity scanning diadenylate cyclase DisA | - |
| I6I08_RS08975 | 2120882..2121520 | - | 639 | WP_070513382.1 | hypothetical protein | - |
| I6I08_RS08980 | 2122272..2123159 | - | 888 | WP_198498176.1 | A/G-specific adenine glycosylase | - |
| I6I08_RS08985 | 2123356..2123967 | - | 612 | WP_075378841.1 | hypothetical protein | - |
| I6I08_RS08990 | 2124389..2125297 | - | 909 | WP_081379373.1 | hypothetical protein | - |
| I6I08_RS08995 | 2125455..2126087 | - | 633 | WP_075378840.1 | hypothetical protein | - |
| I6I08_RS09000 | 2126210..2126695 | - | 486 | WP_075378839.1 | hypothetical protein | - |
| I6I08_RS09005 | 2126835..2127467 | - | 633 | WP_075378915.1 | amino-acid N-acetyltransferase | - |
| I6I08_RS09010 | 2127594..2128748 | - | 1155 | WP_075378838.1 | helix-turn-helix domain-containing protein | - |
| I6I08_RS09015 | 2129136..2130935 | + | 1800 | WP_141407464.1 | glycerol-3-phosphate dehydrogenase/oxidase | - |
| I6I08_RS09020 | 2131102..2131869 | + | 768 | WP_075378836.1 | aquaporin family protein | - |
| I6I08_RS09025 | 2131960..2133513 | + | 1554 | WP_075378835.1 | glycerol kinase GlpK | - |
| I6I08_RS09030 | 2133742..2135805 | + | 2064 | WP_081379372.1 | cation-translocating P-type ATPase | - |
| I6I08_RS09035 | 2136227..2137936 | + | 1710 | WP_081379371.1 | L-lactate permease | - |
| I6I08_RS09040 | 2138988..2139821 | + | 834 | WP_075378834.1 | chromosome condensation regulator | - |
| I6I08_RS09045 | 2140351..2141181 | + | 831 | WP_003789184.1 | (Fe-S)-binding protein | - |
| I6I08_RS09050 | 2141178..2142911 | + | 1734 | WP_075378833.1 | iron-sulfur cluster-binding protein | - |
| I6I08_RS09055 | 2142911..2143561 | + | 651 | WP_060956706.1 | lactate utilization protein C | - |
| I6I08_RS09060 | 2143781..2145289 | + | 1509 | WP_075378912.1 | mannitol dehydrogenase family protein | - |
| I6I08_RS09065 | 2145753..2147021 | + | 1269 | WP_003789176.1 | alpha-hydroxy-acid oxidizing protein | - |
| I6I08_RS09070 | 2147333..2148976 | + | 1644 | WP_141407465.1 | oligopeptide:H+ symporter | - |
| I6I08_RS09075 | 2149281..2150852 | + | 1572 | WP_141407466.1 | oligopeptide:H+ symporter | - |
| I6I08_RS09080 | 2151002..2151508 | + | 507 | WP_141407467.1 | ClbS/DfsB family four-helix bundle protein | - |
| I6I08_RS09085 | 2151603..2152703 | - | 1101 | WP_141407468.1 | Fe2+-enterobactin ABC transporter substrate-binding protein | - |
| I6I08_RS09090 | 2152700..2153677 | - | 978 | WP_141407469.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS09095 | 2153674..2154792 | - | 1119 | WP_141407470.1 | iron chelate uptake ABC transporter family permease subunit | - |
| I6I08_RS09100 | 2154789..2155802 | - | 1014 | WP_141407471.1 | iron chelate uptake ABC transporter family permease subunit | - |
| I6I08_RS09105 | 2156042..2156566 | + | 525 | WP_003789164.1 | PadR family transcriptional regulator | - |
| I6I08_RS09110 | 2156563..2157396 | + | 834 | WP_141407472.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS09115 | 2157393..2159606 | + | 2214 | WP_141407473.1 | FtsX-like permease family protein | - |
| I6I08_RS09120 | 2159817..2160533 | + | 717 | WP_141407474.1 | pentapeptide repeat-containing protein | - |
| I6I08_RS09125 | 2160559..2161119 | + | 561 | WP_141407475.1 | DivIVA domain-containing protein | - |
| I6I08_RS09130 | 2161116..2161709 | - | 594 | WP_198498104.1 | RloB family protein | - |
| I6I08_RS09135 | 2161711..2163012 | - | 1302 | WP_141407477.1 | ATP-binding protein | - |
| I6I08_RS09140 | 2163206..2164894 | - | 1689 | WP_141407478.1 | lysine--tRNA ligase | - |
| I6I08_RS09145 | 2165144..2165599 | - | 456 | WP_003789149.1 | aspartate 1-decarboxylase | - |
| I6I08_RS09150 | 2165907..2166920 | - | 1014 | WP_141407479.1 | pantoate--beta-alanine ligase | - |
| I6I08_RS09155 | 2167159..2168127 | + | 969 | WP_198498105.1 | DUF2520 domain-containing protein | - |
| I6I08_RS09160 | 2168280..2170040 | - | 1761 | WP_141407480.1 | PH domain-containing protein | - |
| I6I08_RS09165 | 2170037..2170642 | - | 606 | WP_141407481.1 | PH domain-containing protein | - |
| I6I08_RS09170 | 2170639..2171139 | - | 501 | WP_003789139.1 | DUF3180 family protein | - |
| I6I08_RS09175 | 2171139..2173895 | - | 2757 | WP_141407482.1 | 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase | - |
| I6I08_RS09180 | 2173892..2174788 | - | 897 | WP_141407483.1 | dihydropteroate synthase | - |
| I6I08_RS09185 | 2175155..2177662 | + | 2508 | WP_141407484.1 | FtsX-like permease family protein | - |
| I6I08_RS09190 | 2177937..2178992 | + | 1056 | WP_141407485.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS09195 | 2178992..2181475 | + | 2484 | WP_141407486.1 | ABC transporter permease | - |
| I6I08_RS09200 | 2181546..2181770 | + | 225 | WP_178387890.1 | actinodefensin | - |
| I6I08_RS09205 | 2182094..2182300 | + | 207 | WP_141407488.1 | actinodefensin | - |
| I6I08_RS09210 | 2182600..2182803 | + | 204 | WP_198498106.1 | actinodefensin | - |
| I6I08_RS09215 | 2182999..2183208 | + | 210 | WP_075372939.1 | actinodefensin | - |
| I6I08_RS09220 | 2183335..2183541 | + | 207 | WP_141407489.1 | actinodefensin | - |
| I6I08_RS09225 | 2183865..2184533 | + | 669 | WP_198498177.1 | transposase family protein | - |
| I6I08_RS09230 | 2184723..2184926 | + | 204 | WP_198498107.1 | actinodefensin | - |
| I6I08_RS09235 | 2185125..2185334 | + | 210 | WP_075372939.1 | actinodefensin | - |
| I6I08_RS09240 | 2185426..2186568 | + | 1143 | WP_141407310.1 | actinodefensin-associated protein A | - |
| I6I08_RS09245 | 2186535..2186780 | + | 246 | WP_170198638.1 | actinodefensin-associated protein B | - |
| I6I08_RS09250 | 2186777..2187568 | + | 792 | WP_141407309.1 | hypothetical protein | - |
| I6I08_RS09255 | 2187535..2189289 | + | 1755 | WP_141407308.1 | ABC transporter ATP-binding protein/permease | - |
| I6I08_RS09260 | 2189286..2191247 | + | 1962 | WP_141407307.1 | prolyl oligopeptidase family serine peptidase | - |
| I6I08_RS09265 | 2191301..2191681 | + | 381 | WP_141407306.1 | hypothetical protein | - |
| I6I08_RS09270 | 2191675..2192988 | + | 1314 | WP_141407305.1 | S8 family serine peptidase | - |
| I6I08_RS09275 | 2193023..2193694 | - | 672 | WP_141407304.1 | response regulator transcription factor | - |
| I6I08_RS09280 | 2193737..2194900 | + | 1164 | WP_141407303.1 | histidine kinase | - |
| I6I08_RS09285 | 2196049..2196372 | - | 324 | WP_141407302.1 | multidrug efflux SMR transporter | - |
| I6I08_RS09290 | 2196369..2196722 | - | 354 | WP_141407323.1 | QacE family quaternary ammonium compound efflux SMR transporter | - |
| I6I08_RS09295 | 2196839..2197249 | - | 411 | WP_075372952.1 | YvaD family protein | - |
| I6I08_RS09300 | 2197286..2197789 | - | 504 | WP_141407301.1 | HXXEE domain-containing protein | - |
| I6I08_RS09305 | 2197968..2198486 | - | 519 | WP_198498108.1 | TetR/AcrR family transcriptional regulator | - |
| I6I08_RS09310 | 2198802..2199374 | - | 573 | WP_070513162.1 | GTP cyclohydrolase I FolE | - |
| I6I08_RS09315 | 2199426..2201501 | - | 2076 | WP_141407300.1 | ATP-dependent zinc metalloprotease FtsH | - |
| I6I08_RS09320 | 2201647..2202969 | - | 1323 | WP_141407299.1 | hypothetical protein | - |
| I6I08_RS09325 | 2203191..2203745 | - | 555 | WP_003789094.1 | hypoxanthine phosphoribosyltransferase | - |
| I6I08_RS09330 | 2203859..2205097 | - | 1239 | WP_141407298.1 | zinc-dependent metalloprotease | - |
| I6I08_RS09335 | 2205179..2206576 | - | 1398 | WP_141407297.1 | D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase | - |
| I6I08_RS09340 | 2206812..2207312 | + | 501 | WP_003789087.1 | inorganic diphosphatase | - |
| I6I08_RS09345 | 2207558..2208898 | - | 1341 | WP_170198643.1 | C40 family peptidase | - |
| I6I08_RS09350 | 2209775..2211196 | + | 1422 | WP_141407295.1 | PLP-dependent transferase | - |
| I6I08_RS09355 | 2211208..2212428 | + | 1221 | WP_141407294.1 | homoserine O-acetyltransferase | - |
| I6I08_RS09360 | 2212703..2215438 | + | 2736 | WP_141407293.1 | exo-alpha-sialidase | - |
| I6I08_RS09365 | 2215734..2215886 | - | 153 | Protein_1829 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| I6I08_RS09370 | 2215903..2216157 | - | 255 | WP_141407291.1 | Txe/YoeB family addiction module toxin | - |
| I6I08_RS09375 | 2216157..2216408 | - | 252 | WP_075410880.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| I6I08_RS09380 | 2216583..2216906 | + | 324 | WP_141407322.1 | HigA family addiction module antidote protein | - |
| I6I08_RS09385 | 2217058..2218068 | - | 1011 | WP_141407290.1 | hypothetical protein | - |
| I6I08_RS09390 | 2218203..2219807 | - | 1605 | WP_141407289.1 | Na+/H+ antiporter | - |
| I6I08_RS09395 | 2219998..2221242 | - | 1245 | WP_141407288.1 | type II toxin-antitoxin system HipA family toxin | - |
| I6I08_RS09400 | 2221239..2221526 | - | 288 | WP_009395767.1 | helix-turn-helix domain-containing protein | - |
| I6I08_RS09405 | 2221825..2222115 | - | 291 | WP_141407287.1 | toxin | - |
| I6I08_RS09410 | 2222102..2222374 | - | 273 | WP_141407286.1 | ribbon-helix-helix protein, CopG family | - |
| I6I08_RS09415 | 2222960..2223331 | - | 372 | WP_141407321.1 | PH domain-containing protein | - |
| I6I08_RS09420 | 2223985..2224216 | + | 232 | Protein_1840 | IS110 family transposase | - |
| I6I08_RS09425 | 2225155..2225811 | + | 657 | WP_198498109.1 | transposase family protein | - |
| I6I08_RS09430 | 2225918..2227526 | + | 1609 | Protein_1842 | IS1634 family transposase | - |
| I6I08_RS09435 | 2228412..2229563 | - | 1152 | WP_141407284.1 | hypothetical protein | - |
| I6I08_RS09440 | 2229933..2231018 | - | 1086 | WP_141407283.1 | redox-regulated ATPase YchF | - |
| I6I08_RS09445 | 2231101..2232651 | - | 1551 | WP_141407282.1 | esterase | - |
| I6I08_RS09450 | 2233072..2234361 | + | 1290 | WP_141407281.1 | DNA recombination protein RmuC | - |
| I6I08_RS09455 | 2234520..2234777 | + | 258 | WP_141407280.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
| I6I08_RS09460 | 2235064..2235540 | + | 477 | WP_141407279.1 | Asp23/Gls24 family envelope stress response protein | - |
| I6I08_RS09465 | 2235574..2235750 | + | 177 | WP_003789010.1 | hypothetical protein | - |
| I6I08_RS09470 | 2235753..2236169 | + | 417 | WP_141407278.1 | hypothetical protein | - |
| I6I08_RS09475 | 2236166..2236714 | + | 549 | WP_141407277.1 | alkaline shock response membrane anchor protein AmaP | - |
| I6I08_RS09480 | 2236728..2237378 | + | 651 | WP_141407276.1 | hypothetical protein | - |
| I6I08_RS09485 | 2237368..2238024 | + | 657 | WP_141407275.1 | sigma-70 family RNA polymerase sigma factor | - |
| I6I08_RS09490 | 2238021..2238572 | + | 552 | WP_141407274.1 | Asp23/Gls24 family envelope stress response protein | - |
| I6I08_RS09495 | 2238562..2238933 | + | 372 | WP_141407273.1 | transcriptional regulator | - |
| I6I08_RS09500 | 2239083..2240534 | - | 1452 | WP_170198642.1 | amino acid permease | - |
| I6I08_RS09505 | 2240847..2241914 | - | 1068 | WP_075375717.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
| I6I08_RS09510 | 2241959..2243347 | + | 1389 | WP_075377944.1 | exodeoxyribonuclease VII large subunit | - |
| I6I08_RS09515 | 2243463..2244842 | - | 1380 | WP_075377943.1 | MFS transporter | - |
| I6I08_RS09520 | 2244955..2245692 | + | 738 | WP_075377942.1 | winged helix-turn-helix domain-containing protein | - |
| I6I08_RS09525 | 2245973..2246311 | + | 339 | WP_075377941.1 | exodeoxyribonuclease VII small subunit | - |
| I6I08_RS09530 | 2246919..2247860 | + | 942 | WP_075377940.1 | carbohydrate kinase | - |
| I6I08_RS09535 | 2247989..2249125 | - | 1137 | WP_075377939.1 | AEC family transporter | - |
| I6I08_RS09540 | 2249249..2250220 | - | 972 | WP_141407271.1 | endonuclease/exonuclease/phosphatase family protein | - |
| I6I08_RS09545 | 2250217..2250702 | - | 486 | WP_075377937.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| I6I08_RS09550 | 2250800..2252242 | - | 1443 | WP_141407270.1 | mechanosensitive ion channel | - |
| I6I08_RS09555 | 2252408..2252737 | + | 330 | WP_010614388.1 | PadR family transcriptional regulator | - |
| I6I08_RS09560 | 2252737..2253249 | + | 513 | WP_141407269.1 | hypothetical protein | - |
| I6I08_RS09580 | 2253857..2254231 | + | 375 | WP_020991936.1 | metallopeptidase family protein | - |
| I6I08_RS09585 | 2254301..2255635 | + | 1335 | WP_075377934.1 | glycoside hydrolase family 3 protein | - |
| I6I08_RS09590 | 2255720..2258350 | - | 2631 | WP_141407268.1 | hypothetical protein | - |
| I6I08_RS09595 | 2258720..2259490 | + | 771 | WP_141407320.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS09600 | 2259494..2262076 | + | 2583 | WP_141407267.1 | ABC transporter permease | - |
| I6I08_RS09605 | 2262350..2264218 | + | 1869 | WP_141407319.1 | ABC transporter ATP-binding protein/permease | - |
| I6I08_RS09610 | 2264218..2265954 | + | 1737 | WP_141407266.1 | ABC transporter ATP-binding protein/permease | - |
| I6I08_RS09615 | 2266266..2266754 | + | 489 | WP_141407265.1 | phage holin family protein | - |
| I6I08_RS09620 | 2266751..2267245 | + | 495 | WP_141407264.1 | DUF3618 domain-containing protein | - |
| I6I08_RS09625 | 2267242..2267655 | + | 414 | WP_141407263.1 | DUF3618 domain-containing protein | - |
| I6I08_RS09630 | 2268130..2268757 | + | 628 | Protein_1879 | NYN domain-containing protein | - |
| I6I08_RS09635 | 2268984..2271980 | + | 2997 | WP_141407318.1 | DEAD/DEAH box helicase | - |
| I6I08_RS09640 | 2271980..2276755 | + | 4776 | WP_141407262.1 | class I SAM-dependent DNA methyltransferase | - |
| I6I08_RS09645 | 2276809..2280603 | - | 3795 | WP_141407261.1 | hypothetical protein | - |
| I6I08_RS09650 | 2281232..2281483 | - | 252 | WP_141407260.1 | hypothetical protein | - |
| I6I08_RS09655 | 2281486..2281698 | - | 213 | WP_141407259.1 | hypothetical protein | - |
| I6I08_RS09660 | 2282200..2282460 | - | 261 | WP_141407258.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| I6I08_RS09665 | 2282680..2289228 | + | 6549 | WP_141407257.1 | DEAD/DEAH box helicase | - |
| I6I08_RS09670 | 2289230..2291719 | + | 2490 | WP_141407256.1 | UvrD-helicase domain-containing protein | - |
| I6I08_RS09675 | 2292160..2292363 | + | 204 | WP_003781441.1 | DUF3073 domain-containing protein | - |
| I6I08_RS09680 | 2292630..2293784 | - | 1155 | WP_141407255.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| I6I08_RS09685 | 2293941..2295806 | - | 1866 | WP_141407254.1 | amidophosphoribosyltransferase | - |
| I6I08_RS09690 | 2295868..2297529 | - | 1662 | WP_141407253.1 | RNB domain-containing ribonuclease | - |
| I6I08_RS09695 | 2298002..2298445 | - | 444 | WP_141407252.1 | hypothetical protein | - |
| I6I08_RS09700 | 2298960..2301122 | - | 2163 | WP_141407251.1 | fructose-specific PTS transporter subunit EIIC | - |
| I6I08_RS09705 | 2301360..2302370 | - | 1011 | WP_141407250.1 | 1-phosphofructokinase family hexose kinase | - |
| I6I08_RS09710 | 2302367..2303131 | - | 765 | WP_075379148.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| I6I08_RS09715 | 2303619..2306057 | - | 2439 | WP_141407249.1 | bifunctional metallophosphatase/5'-nucleotidase | - |
| I6I08_RS09720 | 2306409..2307746 | - | 1338 | WP_070513886.1 | NADP-specific glutamate dehydrogenase | - |
| I6I08_RS09725 | 2307934..2308767 | + | 834 | WP_141407248.1 | class I SAM-dependent methyltransferase | - |
| I6I08_RS09730 | 2308805..2309818 | - | 1014 | WP_075374569.1 | TIGR01777 family oxidoreductase | - |
| I6I08_RS09735 | 2309982..2310959 | + | 978 | Protein_1900 | hypothetical protein | - |
| I6I08_RS09740 | 2310991..2311728 | - | 738 | WP_003787666.1 | CDP-alcohol phosphatidyltransferase family protein | - |
| I6I08_RS09745 | 2311926..2315963 | - | 4038 | WP_141407247.1 | hypothetical protein | - |
| I6I08_RS09750 | 2316615..2317007 | - | 393 | WP_141407246.1 | VOC family protein | - |
| I6I08_RS09755 | 2317063..2317539 | + | 477 | WP_141407245.1 | hypothetical protein | - |
| I6I08_RS09760 | 2317728..2320088 | - | 2361 | WP_141407244.1 | phosphoribosylformylglycinamidine synthase subunit PurL | - |
| I6I08_RS09765 | 2320316..2321728 | + | 1413 | WP_060956807.1 | glycosyltransferase | - |
| I6I08_RS09770 | 2321993..2322343 | + | 351 | WP_060956808.1 | TfoX/Sxy family protein | - |
| I6I08_RS09775 | 2322948..2323670 | - | 723 | WP_141407243.1 | phosphoribosylformylglycinamidine synthase subunit PurQ | - |
| I6I08_RS09780 | 2323674..2323928 | - | 255 | WP_141407242.1 | phosphoribosylformylglycinamidine synthase subunit PurS | - |
| I6I08_RS09785 | 2324016..2324720 | - | 705 | WP_198498178.1 | hypothetical protein | - |
| I6I08_RS09790 | 2325748..2326437 | - | 690 | WP_075379136.1 | hypothetical protein | - |
| I6I08_RS09795 | 2326434..2327384 | - | 951 | WP_075379135.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| I6I08_RS09800 | 2327821..2329128 | - | 1308 | WP_075379134.1 | phosphoribosylamine--glycine ligase | - |
| I6I08_RS09805 | 2329293..2331605 | + | 2313 | WP_141407241.1 | TerD family protein | - |
| I6I08_RS09810 | 2331863..2332060 | + | 198 | WP_003787711.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| I6I08_RS09815 | 2332057..2332434 | + | 378 | WP_075379132.1 | type II toxin-antitoxin system VapC family toxin | - |
| I6I08_RS09820 | 2332516..2333109 | + | 594 | WP_075379131.1 | hypothetical protein | - |
| I6I08_RS09825 | 2333097..2334356 | - | 1260 | WP_141407240.1 | hypothetical protein | - |
| I6I08_RS09830 | 2334386..2335720 | - | 1335 | WP_075379129.1 | hypothetical protein | - |
| I6I08_RS09835 | 2335864..2337711 | - | 1848 | WP_075379128.1 | phosphoenolpyruvate carboxykinase (GTP) | - |
| I6I08_RS09840 | 2337955..2338797 | + | 843 | WP_141407239.1 | translation initiation factor 2 | - |
| I6I08_RS09845 | 2338846..2339946 | + | 1101 | WP_141407238.1 | hypothetical protein | - |
| I6I08_RS09850 | 2340000..2340977 | + | 978 | WP_070510390.1 | hypothetical protein | - |
| I6I08_RS09855 | 2341047..2341895 | + | 849 | WP_170198634.1 | hypothetical protein | - |
| I6I08_RS09860 | 2342158..2342910 | + | 753 | WP_141407237.1 | hypothetical protein | - |
| I6I08_RS09865 | 2343005..2343991 | + | 987 | WP_141407236.1 | hypothetical protein | - |
| I6I08_RS09870 | 2344262..2345548 | - | 1287 | WP_141407235.1 | adenylosuccinate synthase | - |
| I6I08_RS09875 | 2345675..2346808 | + | 1134 | WP_141407234.1 | viral protein TPX | - |
| I6I08_RS09880 | 2346905..2347561 | - | 657 | WP_141407233.1 | DUF624 domain-containing protein | - |
| I6I08_RS09885 | 2347674..2348570 | - | 897 | WP_070510404.1 | carbohydrate ABC transporter permease | - |
| I6I08_RS09890 | 2348567..2349412 | - | 846 | WP_003787752.1 | sugar ABC transporter permease | - |
| I6I08_RS09895 | 2349604..2350947 | - | 1344 | WP_070510407.1 | ABC transporter substrate-binding protein | - |
| I6I08_RS09900 | 2351358..2352407 | - | 1050 | WP_075379121.1 | class II fructose-bisphosphate aldolase | - |
| I6I08_RS09905 | 2352605..2353303 | - | 699 | WP_141407316.1 | RNA methyltransferase | - |
| I6I08_RS09910 | 2353357..2353926 | - | 570 | WP_070510411.1 | orotate phosphoribosyltransferase | - |
| I6I08_RS09915 | 2354050..2354547 | - | 498 | WP_003787762.1 | thiol peroxidase | - |
| I6I08_RS09920 | 2354812..2355585 | - | 774 | WP_141407232.1 | SDR family oxidoreductase | - |
| I6I08_RS09925 | 2355650..2356459 | + | 810 | WP_141407315.1 | endonuclease/exonuclease/phosphatase family protein | - |
| I6I08_RS09930 | 2356519..2357370 | - | 852 | WP_141407231.1 | serine hydrolase | - |
| I6I08_RS09935 | 2357633..2358475 | + | 843 | WP_141407230.1 | 3'-5' exonuclease | - |
| I6I08_RS09940 | 2358778..2359905 | - | 1128 | WP_141407229.1 | hypothetical protein | - |
| I6I08_RS09945 | 2359902..2360537 | - | 636 | WP_009406034.1 | dCTP deaminase | - |
| I6I08_RS09950 | 2360621..2360851 | - | 231 | WP_075375649.1 | TM2 domain-containing protein | - |
| I6I08_RS09960 | 2361743..2362219 | + | 477 | WP_060956838.1 | OsmC family protein | - |
| I6I08_RS09965 | 2362487..2363704 | - | 1218 | WP_141407228.1 | extracellular solute-binding protein | - |
| I6I08_RS09970 | 2363892..2364599 | - | 708 | WP_141407227.1 | M50 family metallopeptidase | - |
| I6I08_RS09975 | 2364654..2365346 | - | 693 | WP_070510430.1 | TetR/AcrR family transcriptional regulator | - |
| I6I08_RS09980 | 2365481..2365978 | - | 498 | WP_070510432.1 | NUDIX domain-containing protein | - |
| I6I08_RS09985 | 2365975..2367003 | - | 1029 | WP_141407226.1 | tetratricopeptide repeat protein | - |
| I6I08_RS09990 | 2367000..2368103 | - | 1104 | WP_141407225.1 | VWA domain-containing protein | - |
| I6I08_RS09995 | 2368100..2369212 | - | 1113 | WP_003787792.1 | VWA domain-containing protein | - |
| I6I08_RS10000 | 2369206..2369727 | - | 522 | WP_075414026.1 | alpha-amylase | - |
| I6I08_RS10005 | 2369731..2370732 | - | 1002 | WP_141407224.1 | DUF58 domain-containing protein | - |
| I6I08_RS10010 | 2370756..2372102 | - | 1347 | WP_075379109.1 | AAA family ATPase | - |
| I6I08_RS10015 | 2372316..2373233 | - | 918 | WP_075379108.1 | DUF2993 domain-containing protein | - |
| I6I08_RS10020 | 2373250..2374083 | - | 834 | WP_009405622.1 | hypothetical protein | - |
| I6I08_RS10025 | 2374183..2375618 | - | 1436 | Protein_1957 | hypothetical protein | - |
| I6I08_RS10030 | 2375615..2376481 | - | 867 | WP_141407222.1 | protein phosphatase 2C domain-containing protein | - |
| I6I08_RS10035 | 2376894..2378195 | + | 1302 | WP_141407221.1 | hypothetical protein | - |
| I6I08_RS10040 | 2378300..2379553 | + | 1254 | WP_141407220.1 | MFS transporter | - |
| I6I08_RS10045 | 2379701..2380972 | + | 1272 | WP_141407314.1 | DUF2029 domain-containing protein | - |
| I6I08_RS10050 | 2381115..2382377 | + | 1263 | WP_075379102.1 | DUF2183 domain-containing protein | - |
| I6I08_RS10055 | 2382619..2382957 | + | 339 | WP_141407219.1 | hypothetical protein | - |
| I6I08_RS10060 | 2383117..2383434 | + | 318 | WP_010613035.1 | hypothetical protein | - |
| I6I08_RS10065 | 2383481..2384260 | - | 780 | WP_075414057.1 | trimeric intracellular cation channel family protein | - |
| I6I08_RS10070 | 2384489..2385403 | + | 915 | WP_141407218.1 | cation diffusion facilitator family transporter | - |
| I6I08_RS10075 | 2385469..2386380 | + | 912 | WP_178389389.1 | copper homeostasis protein CutC | - |
| I6I08_RS10080 | 2386675..2387496 | + | 822 | WP_141407217.1 | alpha/beta hydrolase | - |
| I6I08_RS10085 | 2387566..2388813 | - | 1248 | WP_170198639.1 | hypothetical protein | - |
| I6I08_RS10090 | 2389244..2394025 | + | 4782 | WP_141407216.1 | DUF3418 domain-containing protein | - |
| I6I08_RS10095 | 2394353..2395291 | + | 939 | WP_081379397.1 | ABC transporter permease subunit | - |
| I6I08_RS10100 | 2396009..2397535 | - | 1527 | WP_075379098.1 | PLDc N-terminal domain-containing protein | - |
| I6I08_RS10105 | 2397961..2398761 | - | 801 | WP_075379158.1 | hemagglutinin | - |
| I6I08_RS10110 | 2399231..2399785 | + | 555 | WP_141407215.1 | SprT-like domain-containing protein | - |
| I6I08_RS10115 | 2399824..2400153 | + | 330 | WP_003787857.1 | heavy metal-binding domain-containing protein | - |
| I6I08_RS10120 | 2400591..2401019 | + | 429 | WP_141407214.1 | DUF2218 domain-containing protein | - |
| I6I08_RS10125 | 2401125..2402570 | - | 1446 | WP_141407213.1 | MFS transporter | - |
| I6I08_RS10130 | 2402632..2403477 | - | 846 | WP_141407212.1 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | - |
| I6I08_RS10135 | 2403525..2404007 | - | 483 | WP_003779424.1 | CarD family transcriptional regulator | - |
| I6I08_RS10140 | 2404150..2404881 | - | 732 | WP_141407312.1 | response regulator transcription factor | - |
| I6I08_RS10145 | 2404977..2406212 | - | 1236 | WP_141407211.1 | two-component sensor histidine kinase | - |
| I6I08_RS10150 | 2406415..2407095 | + | 681 | WP_003787867.1 | phosphate signaling complex protein PhoU | - |
| I6I08_RS10155 | 2407186..2407923 | - | 738 | WP_075253629.1 | phosphoglyceromutase | - |
| I6I08_RS10160 | 2408193..2408522 | - | 330 | WP_003787869.1 | Lsr2 family protein | - |
| I6I08_RS10170 | 2409529..2411076 | + | 1548 | WP_141407210.1 | amino acid permease | - |
| I6I08_RS10175 | 2411096..2412094 | + | 999 | WP_101558927.1 | asparaginase | - |
| I6I08_RS10180 | 2412240..2413847 | - | 1608 | WP_141407209.1 | alpha/beta hydrolase | - |
| I6I08_RS10185 | 2413935..2415605 | - | 1671 | WP_141407311.1 | alpha/beta hydrolase | - |
| I6I08_RS10190 | 2415856..2417493 | - | 1638 | WP_198498110.1 | alpha/beta hydrolase | - |
| I6I08_RS10195 | 2417575..2418159 | - | 585 | WP_141405745.1 | hypothetical protein | - |
| I6I08_RS10200 | 2418278..2419531 | - | 1254 | WP_141405746.1 | DNA polymerase III subunit delta' | - |
| I6I08_RS10205 | 2419528..2420316 | - | 789 | WP_141405747.1 | dTMP kinase | - |
| I6I08_RS10210 | 2420452..2421255 | - | 804 | WP_141405748.1 | ABC-2 transporter permease | - |
| I6I08_RS10215 | 2421299..2422027 | - | 729 | WP_141405749.1 | hypothetical protein | - |
| I6I08_RS10220 | 2422024..2422737 | - | 714 | WP_141405750.1 | ABC-2 transporter permease | - |
| I6I08_RS10225 | 2422730..2423557 | - | 828 | WP_141405751.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS10230 | 2423554..2423964 | - | 411 | WP_003787881.1 | GntR family transcriptional regulator | - |
| I6I08_RS10235 | 2424224..2424889 | - | 666 | WP_075379078.1 | DUF3060 domain-containing protein | - |
| I6I08_RS10240 | 2424970..2426208 | - | 1239 | WP_141405752.1 | OmpA family protein | - |
| I6I08_RS10245 | 2426342..2427598 | - | 1257 | WP_141405753.1 | HAMP domain-containing histidine kinase | - |
| I6I08_RS10250 | 2427595..2428323 | - | 729 | WP_075379077.1 | response regulator transcription factor | - |
| I6I08_RS10255 | 2428331..2428948 | - | 618 | WP_075379076.1 | DUF3060 domain-containing protein | - |
| I6I08_RS10260 | 2429364..2432276 | - | 2913 | WP_075379075.1 | type I DNA topoisomerase | - |
| I6I08_RS10265 | 2432499..2433833 | - | 1335 | WP_141405754.1 | diguanylate cyclase | - |
| I6I08_RS10270 | 2434003..2435355 | - | 1353 | WP_009405879.1 | PAS domain S-box protein | - |
| I6I08_RS10275 | 2435658..2436404 | + | 747 | WP_009406511.1 | response regulator transcription factor | - |
| I6I08_RS10280 | 2436415..2438097 | + | 1683 | WP_198498111.1 | HAMP domain-containing histidine kinase | - |
| I6I08_RS10285 | 2438274..2439257 | - | 984 | WP_141405755.1 | phosphatase PAP2 family protein | - |
| I6I08_RS10290 | 2439326..2440726 | - | 1401 | WP_075379071.1 | class C sortase | - |
| I6I08_RS10295 | 2440943..2442544 | - | 1602 | WP_141405756.1 | SpaH/EbpB family LPXTG-anchored major pilin | - |
| I6I08_RS10300 | 2442634..2446875 | - | 4242 | WP_141405757.1 | DUF11 domain-containing protein | - |
| I6I08_RS10305 | 2447199..2448863 | - | 1665 | WP_141405758.1 | methyltransferase | - |
| I6I08_RS10310 | 2448950..2449960 | - | 1011 | WP_141405759.1 | MsnO8 family LLM class oxidoreductase | - |
| I6I08_RS10315 | 2450285..2450863 | + | 579 | WP_009747315.1 | peroxiredoxin | - |
| I6I08_RS10320 | 2450920..2451450 | + | 531 | WP_141405760.1 | carboxymuconolactone decarboxylase family protein | - |
| I6I08_RS10325 | 2451544..2452056 | - | 513 | WP_141406226.1 | PH domain-containing protein | - |
| I6I08_RS10330 | 2452140..2452751 | - | 612 | WP_198498179.1 | type II secretion protein F | - |
| I6I08_RS10335 | 2453461..2454714 | - | 1254 | WP_141405761.1 | TadA family conjugal transfer-associated ATPase | - |
| I6I08_RS10340 | 2454702..2455916 | - | 1215 | WP_139018994.1 | hypothetical protein | - |
| I6I08_RS10345 | 2456281..2457210 | + | 930 | WP_075373906.1 | HAD-IB family hydrolase | - |
| I6I08_RS10350 | 2457265..2458252 | - | 988 | Protein_2021 | Fic family protein | - |
| I6I08_RS10355 | 2458533..2459372 | + | 840 | WP_141406229.1 | hypothetical protein | - |
| I6I08_RS10360 | 2461742..2462299 | + | 558 | WP_075379152.1 | hypothetical protein | - |
| I6I08_RS10365 | 2462361..2463083 | + | 723 | WP_141406231.1 | AzlC family ABC transporter permease | - |
| I6I08_RS10370 | 2463083..2463406 | + | 324 | WP_141405763.1 | AzlD domain-containing protein | - |
| I6I08_RS10375 | 2463387..2464181 | - | 795 | WP_141405764.1 | DUF1211 domain-containing protein | - |
| I6I08_RS10380 | 2464452..2465360 | + | 909 | WP_141405765.1 | alpha/beta hydrolase | - |
| I6I08_RS10385 | 2465474..2466862 | - | 1389 | WP_141405766.1 | ABC transporter permease | - |
| I6I08_RS10390 | 2466897..2467736 | - | 840 | WP_141405767.1 | ATP-binding cassette domain-containing protein | - |
| I6I08_RS10395 | 2467943..2468713 | - | 771 | WP_141406232.1 | endonuclease III | - |
| I6I08_RS10400 | 2468965..2469681 | + | 717 | WP_050783177.1 | Crp/Fnr family transcriptional regulator | - |
| I6I08_RS10405 | 2469838..2470029 | - | 192 | WP_141405768.1 | DUF4177 domain-containing protein | - |
| I6I08_RS10410 | 2470087..2470422 | - | 336 | WP_075249609.1 | WhiB family transcriptional regulator | - |
| I6I08_RS10415 | 2470939..2473014 | + | 2076 | WP_141405769.1 | transglycosylase domain-containing protein | - |
| I6I08_RS10420 | 2473066..2474052 | + | 987 | WP_141405770.1 | metallophosphoesterase | - |
| I6I08_RS10425 | 2474227..2475123 | - | 897 | WP_141405771.1 | SDR family oxidoreductase | - |
| I6I08_RS10430 | 2475364..2475912 | - | 549 | WP_141405772.1 | O-acetyl-ADP-ribose deacetylase | - |
| I6I08_RS10440 | 2476293..2476505 | + | 213 | WP_141405773.1 | hypothetical protein | - |
| I6I08_RS10445 | 2476721..2477182 | + | 462 | WP_075379052.1 | hypothetical protein | - |
| I6I08_RS10450 | 2477410..2478969 | + | 1560 | WP_141406234.1 | NAD(+)/NADH kinase | - |
| I6I08_RS10455 | 2479161..2480471 | + | 1311 | WP_141405774.1 | Mur ligase family protein | - |
| I6I08_RS10460 | 2480468..2481223 | + | 756 | WP_141405775.1 | glutamine amidotransferase | - |
| I6I08_RS10465 | 2481562..2481762 | + | 201 | WP_101558972.1 | PspC domain-containing protein | - |
| I6I08_RS10470 | 2482167..2482562 | + | 396 | WP_003788016.1 | ferrous iron transport protein A | - |
| I6I08_RS10475 | 2482559..2484688 | + | 2130 | WP_141405776.1 | ferrous iron transporter B | - |
| I6I08_RS10480 | 2484771..2485307 | + | 537 | WP_141405777.1 | NifU family protein | - |
| I6I08_RS10485 | 2485554..2485931 | + | 378 | WP_141405778.1 | ferrous iron transport protein A | - |
| I6I08_RS10490 | 2485928..2488027 | + | 2100 | WP_141405779.1 | ferrous iron transporter B | - |
| I6I08_RS10495 | 2488269..2488769 | + | 501 | WP_141405780.1 | NUDIX domain-containing protein | - |
| I6I08_RS10500 | 2488942..2489454 | - | 513 | WP_141405781.1 | VOC family protein | - |
| I6I08_RS10505 | 2489699..2490343 | - | 645 | WP_141405782.1 | isochorismatase family protein | - |
| I6I08_RS10510 | 2490511..2491575 | + | 1065 | WP_141405783.1 | helix-turn-helix domain-containing protein | - |
| I6I08_RS10515 | 2491907..2492134 | + | 228 | WP_141405784.1 | toxin-antitoxin system antitoxin subunit | - |
| I6I08_RS10520 | 2492131..2492532 | + | 402 | WP_141405785.1 | PIN domain-containing protein | - |
| I6I08_RS10525 | 2492791..2494119 | - | 1329 | WP_141405786.1 | alpha-amylase family protein | - |
| I6I08_RS10530 | 2494158..2494775 | + | 618 | WP_141405787.1 | TetR/AcrR family transcriptional regulator | - |
| I6I08_RS10535 | 2494907..2495404 | - | 498 | WP_198498112.1 | DNA starvation/stationary phase protection protein | - |
| I6I08_RS10540 | 2495870..2496574 | - | 705 | WP_141405789.1 | hypothetical protein | - |
| I6I08_RS10545 | 2497010..2497402 | - | 393 | WP_003788050.1 | type II toxin-antitoxin system VapC family toxin | - |
| I6I08_RS10550 | 2497399..2497620 | - | 222 | WP_003788052.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| I6I08_RS10555 | 2497826..2498635 | - | 810 | WP_003788055.1 | chlorite dismutase family protein | - |
| I6I08_RS10560 | 2498676..2500115 | - | 1440 | WP_141405791.1 | ferrochelatase | - |
| I6I08_RS10565 | 2500108..2501603 | - | 1496 | Protein_2063 | glutamyl-tRNA reductase | - |
| I6I08_RS10570 | 2501980..2503161 | + | 1182 | WP_141406236.1 | uroporphyrinogen decarboxylase | - |
| I6I08_RS10575 | 2503158..2504834 | + | 1677 | WP_141405793.1 | FAD-dependent oxidoreductase | - |
| I6I08_RS10580 | 2504964..2506226 | + | 1263 | WP_141405794.1 | hydroxymethylbilane synthase | - |
| I6I08_RS10585 | 2506231..2507322 | + | 1092 | WP_141405795.1 | uroporphyrinogen-III synthase | - |
| I6I08_RS10590 | 2507621..2508670 | + | 1050 | WP_141405796.1 | porphobilinogen synthase | - |
| I6I08_RS10595 | 2508779..2510251 | + | 1473 | WP_141405797.1 | glutamate-1-semialdehyde 2,1-aminomutase | - |
| I6I08_RS10600 | 2510461..2511402 | - | 942 | WP_141405798.1 | macro domain-containing protein | - |
| I6I08_RS10605 | 2511541..2511921 | - | 381 | WP_060956929.1 | thioredoxin family protein | - |
| I6I08_RS10610 | 2512455..2513363 | + | 909 | WP_075377843.1 | hypothetical protein | - |
| I6I08_RS10615 | 2513679..2514869 | + | 1191 | WP_081379293.1 | Fic family protein | - |
| I6I08_RS10620 | 2515098..2516033 | + | 936 | WP_141405799.1 | hypothetical protein | - |
| I6I08_RS10625 | 2516226..2516981 | + | 756 | WP_141405800.1 | potassium channel family protein | - |
| I6I08_RS10630 | 2517382..2518164 | + | 783 | WP_141405801.1 | hypothetical protein | - |
| I6I08_RS10635 | 2518281..2519360 | - | 1080 | WP_075377846.1 | aspartate-semialdehyde dehydrogenase | - |
| I6I08_RS10640 | 2519357..2520838 | - | 1482 | WP_141405802.1 | aspartate kinase | - |
| I6I08_RS10645 | 2521168..2522112 | + | 945 | WP_070512033.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS10650 | 2522109..2523197 | + | 1089 | WP_070512036.1 | ABC transporter permease | - |
| I6I08_RS10655 | 2523309..2523917 | - | 609 | WP_003788101.1 | recombination mediator RecR | - |
| I6I08_RS10660 | 2525668..2527656 | - | 1989 | Protein_2082 | DNA polymerase III subunit gamma and tau | - |
| I6I08_RS10665 | 2527769..2528275 | + | 507 | WP_141405803.1 | carbonic anhydrase | - |
| I6I08_RS10680 | 2528744..2529355 | + | 612 | WP_141405804.1 | septum formation family protein | - |
| I6I08_RS10685 | 2529602..2530075 | + | 474 | WP_070510005.1 | septum formation family protein | - |
| I6I08_RS10690 | 2530292..2530999 | + | 708 | WP_075378001.1 | TetR family transcriptional regulator | - |
| I6I08_RS10695 | 2531068..2532150 | - | 1083 | WP_141405805.1 | hypothetical protein | - |
| I6I08_RS10700 | 2532549..2532887 | + | 339 | WP_070510020.1 | antitoxin VapB | - |
| I6I08_RS10705 | 2533044..2533619 | + | 576 | WP_020992016.1 | LytR C-terminal domain-containing protein | - |
| I6I08_RS10710 | 2534074..2535522 | - | 1449 | WP_003788124.1 | nitrate reductase | - |
| I6I08_RS10715 | 2535775..2536158 | + | 384 | WP_141405806.1 | DUF4190 domain-containing protein | - |
| I6I08_RS10720 | 2536205..2536942 | + | 738 | WP_075378005.1 | hypothetical protein | - |
| I6I08_RS10725 | 2537033..2538481 | + | 1449 | WP_141405807.1 | annexin A7 | - |
| I6I08_RS10730 | 2538782..2539960 | + | 1179 | WP_170198576.1 | hypothetical protein | - |
| I6I08_RS10735 | 2540120..2540422 | + | 303 | WP_141405809.1 | hypothetical protein | - |
| I6I08_RS10740 | 2540514..2541200 | - | 687 | WP_009406653.1 | SDR family oxidoreductase | - |
| I6I08_RS10745 | 2541349..2542083 | - | 735 | WP_101559011.1 | glutamine amidotransferase | - |
| I6I08_RS10750 | 2542151..2542972 | - | 822 | WP_101559012.1 | purine-nucleoside phosphorylase | - |
| I6I08_RS10755 | 2543220..2543594 | - | 375 | WP_141406237.1 | hypothetical protein | - |
| I6I08_RS10760 | 2543734..2543922 | - | 189 | WP_141405810.1 | helix-turn-helix transcriptional regulator | - |
| I6I08_RS10765 | 2543959..2544363 | - | 405 | WP_141405811.1 | PTS sugar transporter | - |
| I6I08_RS10770 | 2544676..2545044 | + | 369 | WP_141405812.1 | hypothetical protein | - |
| I6I08_RS10775 | 2545189..2548242 | + | 3054 | WP_141405813.1 | DEAD/DEAH box helicase | - |
| I6I08_RS10780 | 2548451..2548912 | - | 462 | WP_075378011.1 | nuclear transport factor 2 family protein | - |
| I6I08_RS10785 | 2549428..2550177 | + | 750 | WP_141405814.1 | hypothetical protein | - |
| I6I08_RS10790 | 2550441..2551283 | - | 843 | WP_141405815.1 | hypothetical protein | - |
| I6I08_RS10795 | 2551292..2551588 | - | 297 | WP_141405816.1 | hypothetical protein | - |
| I6I08_RS10800 | 2551683..2552111 | - | 429 | WP_141405817.1 | hypothetical protein | - |
| I6I08_RS10805 | 2552140..2553270 | - | 1131 | WP_141405818.1 | helix-turn-helix domain-containing protein | - |
| I6I08_RS10810 | 2553267..2553707 | - | 441 | WP_141405819.1 | hypothetical protein | - |
| I6I08_RS10815 | 2553749..2554192 | - | 444 | WP_141405820.1 | hypothetical protein | - |
| I6I08_RS10820 | 2554339..2554800 | - | 462 | WP_141405821.1 | hypothetical protein | - |
| I6I08_RS10825 | 2554828..2555295 | - | 468 | WP_141405822.1 | helix-turn-helix domain-containing protein | - |
| I6I08_RS10830 | 2555314..2555553 | - | 240 | WP_141405823.1 | helix-turn-helix domain-containing protein | - |
| I6I08_RS10835 | 2555677..2556195 | + | 519 | WP_170198561.1 | helix-turn-helix domain-containing protein | - |
| I6I08_RS10840 | 2557528..2557902 | + | 375 | WP_198498180.1 | tyrosine-type recombinase/integrase | - |
| I6I08_RS10850 | 2558189..2558782 | - | 594 | WP_198498113.1 | nucleoside deaminase | - |
| I6I08_RS10855 | 2558951..2561185 | + | 2235 | WP_141405826.1 | choline BCCT transporter BetT | - |
| I6I08_RS10860 | 2561453..2562316 | - | 864 | WP_141405827.1 | aldo/keto reductase | - |
| I6I08_RS10865 | 2562904..2564262 | - | 1359 | WP_141405828.1 | ABC transporter permease | - |
| I6I08_RS10870 | 2564259..2565107 | - | 849 | WP_081386032.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS10875 | 2565104..2565295 | - | 192 | Protein_2122 | hypothetical protein | - |
| I6I08_RS10880 | 2565638..2567110 | + | 1473 | WP_141405829.1 | sensor histidine kinase | - |
| I6I08_RS10885 | 2567125..2568018 | + | 894 | WP_141405830.1 | response regulator transcription factor | - |
| I6I08_RS10890 | 2568629..2569267 | + | 639 | WP_003788190.1 | uracil phosphoribosyltransferase | - |
| I6I08_RS10895 | 2569368..2571440 | + | 2073 | WP_141405831.1 | hypothetical protein | - |
| I6I08_RS10900 | 2571462..2572958 | - | 1497 | Protein_2127 | IS1634 family transposase | - |
| I6I08_RS10905 | 2573256..2574074 | - | 819 | WP_141405832.1 | DNA methyltransferase | - |
| I6I08_RS10910 | 2574605..2574754 | + | 150 | WP_170198562.1 | hypothetical protein | - |
| I6I08_RS10915 | 2574760..2576394 | + | 1635 | WP_141405833.1 | HAMP domain-containing histidine kinase | - |
| I6I08_RS10920 | 2576391..2577962 | + | 1572 | WP_141405834.1 | anion permease | - |
| I6I08_RS10925 | 2578040..2579236 | + | 1197 | WP_141405835.1 | glycerate kinase | - |
| I6I08_RS10930 | 2579705..2581264 | + | 1560 | WP_141405836.1 | type I restriction-modification system subunit M | - |
| I6I08_RS10935 | 2581261..2582472 | + | 1212 | WP_141405837.1 | restriction endonuclease subunit S | - |
| I6I08_RS10940 | 2582477..2583415 | + | 939 | WP_141405838.1 | GIY-YIG nuclease family protein | - |
| I6I08_RS10945 | 2583431..2586487 | + | 3057 | WP_141405839.1 | type I restriction endonuclease subunit R | - |
| I6I08_RS10950 | 2586740..2587693 | + | 954 | WP_141405840.1 | hypothetical protein | - |
| I6I08_RS10955 | 2587998..2588690 | - | 693 | WP_075378015.1 | response regulator transcription factor | - |
| I6I08_RS10960 | 2588694..2589965 | - | 1272 | WP_141406239.1 | two-component sensor histidine kinase | - |
| I6I08_RS10965 | 2590132..2591523 | - | 1392 | WP_141405841.1 | FtsX-like permease family protein | - |
| I6I08_RS10970 | 2591520..2592239 | - | 720 | WP_075378020.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS10975 | 2592872..2593729 | - | 858 | WP_075378021.1 | ABC transporter substrate-binding protein | - |
| I6I08_RS10980 | 2593858..2594574 | - | 717 | WP_075378022.1 | ABC transporter permease | - |
| I6I08_RS10985 | 2594571..2595734 | - | 1164 | WP_141405842.1 | ATP-binding cassette domain-containing protein | - |
| I6I08_RS10990 | 2596093..2597088 | + | 996 | WP_075378024.1 | alpha/beta hydrolase | - |
| I6I08_RS10995 | 2597127..2597684 | - | 558 | WP_198498181.1 | low molecular weight phosphotyrosine protein phosphatase | - |
| I6I08_RS11000 | 2598210..2599154 | - | 945 | WP_075254466.1 | prephenate dehydratase | - |
| I6I08_RS11005 | 2599368..2600309 | + | 942 | WP_141405843.1 | fructosamine kinase family protein | - |
| I6I08_RS11010 | 2600378..2602807 | + | 2430 | WP_141406242.1 | hypothetical protein | - |
| I6I08_RS11015 | 2602804..2603685 | - | 882 | WP_141405844.1 | glycosyltransferase | - |
| I6I08_RS11020 | 2604189..2606003 | - | 1815 | WP_170198578.1 | DUF885 domain-containing protein | - |
| I6I08_RS11025 | 2607333..2607944 | + | 612 | WP_141405846.1 | NAD(P)H-dependent oxidoreductase | - |
| I6I08_RS11030 | 2607948..2608694 | + | 747 | WP_141405847.1 | DNA alkylation repair protein | - |
| I6I08_RS11035 | 2608957..2609814 | + | 858 | WP_141405848.1 | DUF817 domain-containing protein | - |
| I6I08_RS11040 | 2610237..2611127 | - | 891 | WP_141405849.1 | topoisomerase II | - |
| I6I08_RS11045 | 2611284..2612678 | + | 1395 | WP_141405850.1 | serine/arginine repetitive matrix protein 1 | - |
| I6I08_RS11050 | 2612687..2613985 | - | 1299 | WP_141405851.1 | DUF5129 domain-containing protein | - |
| I6I08_RS11055 | 2613964..2615622 | - | 1659 | WP_141405852.1 | DUF5129 domain-containing protein | - |
| I6I08_RS11060 | 2615619..2616599 | - | 981 | WP_141405853.1 | DUF5129 domain-containing protein | - |
| I6I08_RS11065 | 2616747..2618342 | - | 1596 | WP_141405854.1 | DUF5129 domain-containing protein | - |
| I6I08_RS11070 | 2618453..2620096 | - | 1644 | WP_170198563.1 | DUF5129 domain-containing protein | - |
| I6I08_RS11075 | 2620146..2621177 | - | 1032 | WP_141405855.1 | DUF5129 domain-containing protein | - |
| I6I08_RS11080 | 2621588..2623789 | + | 2202 | WP_141405856.1 | hypothetical protein | - |
| I6I08_RS11085 | 2623826..2624224 | - | 399 | WP_141405857.1 | RidA family protein | - |
| I6I08_RS11090 | 2624421..2625407 | + | 987 | WP_141405858.1 | hypothetical protein | - |
| I6I08_RS11095 | 2625707..2627389 | + | 1683 | WP_141405859.1 | phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent) | - |
| I6I08_RS11100 | 2627903..2628472 | + | 570 | WP_141405860.1 | GNAT family N-acetyltransferase | - |
| I6I08_RS11105 | 2628938..2629906 | + | 969 | WP_141405861.1 | hypothetical protein | - |
| I6I08_RS11110 | 2630131..2631315 | + | 1185 | WP_198498114.1 | YwiC-like family protein | - |
| I6I08_RS11115 | 2631377..2632534 | - | 1158 | WP_141405862.1 | histidinol-phosphate transaminase | - |
| I6I08_RS11120 | 2632581..2632988 | + | 408 | WP_141405863.1 | phage holin family protein | - |
| I6I08_RS11125 | 2633131..2634939 | - | 1809 | WP_141406249.1 | hypothetical protein | - |
| I6I08_RS11130 | 2635095..2635316 | - | 222 | WP_075374848.1 | hypothetical protein | - |
| I6I08_RS11135 | 2635861..2636532 | - | 672 | WP_141405864.1 | class I SAM-dependent methyltransferase | - |
| I6I08_RS11140 | 2636635..2637939 | + | 1305 | WP_141405865.1 | C1 family peptidase | - |
| I6I08_RS11145 | 2638180..2638938 | + | 759 | WP_141406251.1 | SIP domain-containing protein | - |
| I6I08_RS11150 | 2639059..2639430 | + | 372 | WP_141405866.1 | hypothetical protein | - |
| I6I08_RS11155 | 2639437..2639646 | - | 210 | WP_198498182.1 | toxin-antitoxin system, antitoxin component domain protein | - |
| I6I08_RS11160 | 2639823..2640293 | - | 471 | WP_141405868.1 | XRE family transcriptional regulator | - |
| I6I08_RS11165 | 2640796..2641206 | + | 411 | WP_075378744.1 | hypothetical protein | - |
| I6I08_RS11170 | 2641212..2642657 | + | 1446 | WP_141405869.1 | adenylosuccinate lyase | - |
| I6I08_RS11175 | 2643303..2644556 | - | 1254 | WP_141405870.1 | thiopeptide-type bacteriocin biosynthesis protein | - |
| I6I08_RS11180 | 2644553..2647039 | - | 2487 | WP_170198580.1 | lantibiotic dehydratase | - |
| I6I08_RS11185 | 2647192..2648427 | - | 1236 | WP_141406253.1 | hypothetical protein | - |
| I6I08_RS11190 | 2648526..2648729 | - | 204 | WP_020992058.1 | thiocillin family RiPP | - |
| I6I08_RS11195 | 2648947..2649684 | - | 738 | WP_141405872.1 | hypothetical protein | - |
| I6I08_RS11200 | 2649674..2651506 | - | 1833 | WP_141405873.1 | bacteriocin biosynthesis protein | - |
| I6I08_RS11205 | 2651508..2652227 | - | 720 | WP_170198581.1 | cyclodehydratase | - |
| I6I08_RS11210 | 2652287..2653705 | - | 1419 | WP_141405875.1 | YcaO-like family protein | - |
| I6I08_RS11215 | 2653970..2654695 | + | 726 | WP_075378752.1 | response regulator transcription factor | - |
| I6I08_RS11220 | 2654749..2655747 | - | 999 | WP_141405876.1 | hypothetical protein | - |
| I6I08_RS11225 | 2655894..2656175 | + | 282 | WP_010612815.1 | metal-sensitive transcriptional regulator | - |
| I6I08_RS11230 | 2656260..2656529 | + | 270 | WP_003788344.1 | heavy-metal-associated domain-containing protein | - |
| I6I08_RS11235 | 2656629..2659355 | + | 2727 | WP_141405877.1 | HAD-IC family P-type ATPase | - |
| I6I08_RS11240 | 2659994..2660572 | + | 579 | WP_141405878.1 | hypothetical protein | - |
| I6I08_RS11245 | 2660566..2661162 | + | 597 | WP_141405879.1 | hypothetical protein | - |
| I6I08_RS11250 | 2661159..2661824 | + | 666 | WP_141405880.1 | hypothetical protein | - |
| I6I08_RS11255 | 2662236..2663612 | + | 1377 | WP_141405881.1 | pyridoxal phosphate-dependent aminotransferase | - |
| I6I08_RS11260 | 2663744..2664952 | + | 1209 | WP_141405882.1 | PLP-dependent transferase | - |
| I6I08_RS11265 | 2665068..2666930 | + | 1863 | WP_141405883.1 | alpha/beta hydrolase | - |
| I6I08_RS11275 | 2667269..2668603 | - | 1335 | WP_141405884.1 | hypothetical protein | - |
| I6I08_RS11285 | 2669124..2669834 | + | 711 | WP_141405885.1 | DNA alkylation repair protein | - |
| I6I08_RS11290 | 2669936..2670919 | - | 984 | WP_075378762.1 | WYL domain-containing protein | - |
| I6I08_RS11295 | 2671024..2671410 | + | 387 | WP_141405886.1 | VOC family protein | - |
| I6I08_RS11300 | 2672032..2673448 | - | 1417 | Protein_2205 | DHA2 family efflux MFS transporter permease subunit | - |
| I6I08_RS11310 | 2674115..2675464 | - | 1350 | WP_141405887.1 | AGE family epimerase/isomerase | - |
| I6I08_RS11315 | 2675610..2677271 | - | 1662 | WP_141405888.1 | ABC transporter substrate-binding protein | - |
| I6I08_RS11320 | 2677271..2678404 | - | 1134 | WP_141405889.1 | Cof-type HAD-IIB family hydrolase | - |
| I6I08_RS11325 | 2678416..2679696 | - | 1281 | WP_141405890.1 | serine--tRNA ligase | - |
| I6I08_RS11330 | 2680257..2681201 | + | 945 | WP_070511153.1 | hydrogen peroxide-inducible genes activator | - |
| I6I08_RS11335 | 2681309..2682529 | + | 1221 | WP_141405891.1 | diacylglycerol kinase | - |
| I6I08_RS11340 | 2682568..2683962 | - | 1395 | WP_141405892.1 | amidohydrolase | - |
| I6I08_RS11345 | 2684172..2685029 | - | 858 | WP_198498115.1 | hypothetical protein | - |
| I6I08_RS11350 | 2685026..2686372 | - | 1347 | WP_141406255.1 | LssY C-terminal domain-containing protein | - |
| I6I08_RS11355 | 2686608..2687330 | - | 723 | WP_075374183.1 | hypothetical protein | - |
| I6I08_RS11360 | 2687442..2688416 | - | 975 | WP_075374182.1 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
| I6I08_RS11365 | 2688590..2689192 | + | 603 | WP_003788384.1 | DUF1269 domain-containing protein | - |
| I6I08_RS11370 | 2689314..2690258 | - | 945 | WP_075374181.1 | hypothetical protein | - |
| I6I08_RS11375 | 2690340..2691281 | - | 942 | WP_075374180.1 | hypothetical protein | - |
| I6I08_RS11380 | 2691499..2696577 | + | 5079 | WP_198498116.1 | DEAD/DEAH box helicase family protein | - |
| I6I08_RS11385 | 2696574..2697086 | + | 513 | WP_141405893.1 | hypothetical protein | - |
| I6I08_RS11390 | 2697298..2698242 | + | 945 | WP_198498183.1 | ATP-binding protein | - |
| I6I08_RS11395 | 2698246..2700780 | + | 2535 | WP_075379534.1 | S8 family peptidase | - |
| I6I08_RS11400 | 2700816..2700908 | + | 93 | Protein_2224 | plasmid maintenance system killer protein | - |
| I6I08_RS11405 | 2700938..2702008 | + | 1071 | WP_075379533.1 | ImmA/IrrE family metallo-endopeptidase | - |
| I6I08_RS11410 | 2702022..2703506 | - | 1485 | WP_075374178.1 | sugar porter family MFS transporter | - |
| I6I08_RS11415 | 2704005..2704715 | + | 711 | WP_075374177.1 | phosphoribulokinase | - |
| I6I08_RS11420 | 2704840..2705934 | + | 1095 | WP_075374176.1 | bile acid:sodium symporter family protein | - |
| I6I08_RS11425 | 2706109..2706690 | - | 582 | WP_141405894.1 | hypothetical protein | - |
| I6I08_RS11430 | 2706735..2708891 | - | 2157 | WP_141405895.1 | class 1b ribonucleoside-diphosphate reductase subunit alpha | - |
| I6I08_RS11435 | 2708876..2709286 | - | 411 | WP_141405896.1 | class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI | - |
| I6I08_RS11440 | 2709304..2709549 | - | 246 | WP_003788409.1 | glutaredoxin-like protein NrdH | - |
| I6I08_RS11445 | 2710230..2711096 | + | 867 | WP_075378114.1 | DUF4956 domain-containing protein | - |
| I6I08_RS11450 | 2711284..2712105 | + | 822 | WP_141405897.1 | polyphosphate polymerase domain-containing protein | - |
| I6I08_RS11455 | 2712384..2713193 | + | 810 | WP_075374172.1 | DUF4956 domain-containing protein | - |
| I6I08_RS11460 | 2713246..2714262 | + | 1017 | WP_141405898.1 | polyphosphate polymerase domain-containing protein | - |
| I6I08_RS11465 | 2714335..2716092 | + | 1758 | WP_141405899.1 | carbohydrate-binding domain-containing protein | - |
| I6I08_RS11470 | 2716251..2718176 | + | 1926 | WP_141405900.1 | hypothetical protein | - |
| I6I08_RS11475 | 2718190..2719647 | - | 1458 | WP_198498184.1 | L-serine ammonia-lyase | - |
| I6I08_RS11480 | 2719913..2721916 | - | 2004 | WP_141405902.1 | alpha-amylase family protein | - |
| I6I08_RS11485 | 2722366..2722821 | - | 456 | WP_141406258.1 | helix-turn-helix transcriptional regulator | - |
| I6I08_RS11490 | 2723061..2723672 | + | 612 | WP_141405903.1 | NAD(P)H-binding protein | - |
| I6I08_RS11495 | 2723769..2724575 | + | 807 | WP_141405904.1 | bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase | - |
| I6I08_RS11500 | 2724890..2725240 | + | 351 | WP_141405905.1 | PadR family transcriptional regulator | - |
| I6I08_RS11505 | 2725237..2726211 | + | 975 | WP_141405906.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS11510 | 2726208..2726999 | + | 792 | WP_141405908.1 | ABC transporter permease | - |
| I6I08_RS11515 | 2726990..2728414 | - | 1425 | WP_141405910.1 | replicative DNA helicase | - |
| I6I08_RS11520 | 2729177..2730631 | + | 1455 | WP_141405912.1 | MATE family efflux transporter | - |
| I6I08_RS11525 | 2730921..2731853 | + | 933 | WP_141406259.1 | hypothetical protein | - |
| I6I08_RS11530 | 2732035..2732490 | - | 456 | WP_003788450.1 | 50S ribosomal protein L9 | - |
| I6I08_RS11535 | 2732506..2732742 | - | 237 | WP_003783656.1 | 30S ribosomal protein S18 | - |
| I6I08_RS11540 | 2732829..2733437 | - | 609 | WP_075378105.1 | single-stranded DNA-binding protein | - |
| I6I08_RS11545 | 2733465..2733752 | - | 288 | WP_003788455.1 | 30S ribosomal protein S6 | - |
| I6I08_RS11550 | 2734005..2736455 | - | 2451 | WP_141405914.1 | penicillin-binding protein | - |
| I6I08_RS11555 | 2737012..2738388 | + | 1377 | WP_101588171.1 | anaerobic C4-dicarboxylate transporter | - |
| I6I08_RS11560 | 2738538..2741954 | + | 3417 | WP_075378102.1 | hypothetical protein | - |
| I6I08_RS11565 | 2742257..2742415 | - | 159 | WP_009406747.1 | hypothetical protein | - |
| I6I08_RS11570 | 2742415..2743188 | - | 774 | WP_075378101.1 | class E sortase | - |
| I6I08_RS11575 | 2743383..2743898 | + | 516 | WP_070510227.1 | cell division protein CrgA | - |
| I6I08_RS11580 | 2744343..2745197 | - | 855 | WP_141405917.1 | rhomboid family intramembrane serine protease | - |
| I6I08_RS11585 | 2745385..2745906 | - | 522 | WP_029316092.1 | peptidylprolyl isomerase | - |
| I6I08_RS11590 | 2746084..2746629 | + | 546 | WP_009406927.1 | hypothetical protein | - |
| I6I08_RS11595 | 2746786..2747544 | - | 759 | WP_075378098.1 | hypothetical protein | - |
| I6I08_RS11600 | 2748111..2750747 | + | 2637 | WP_141405919.1 | hypothetical protein | - |
| I6I08_RS11605 | 2750849..2751697 | - | 849 | WP_141405921.1 | AraC family transcriptional regulator | - |
| I6I08_RS11610 | 2751694..2752152 | - | 459 | WP_178389455.1 | effector binding domain-containing protein | - |
| I6I08_RS11615 | 2752209..2753180 | - | 972 | WP_141405923.1 | zinc-binding dehydrogenase | - |
| I6I08_RS11620 | 2753316..2753816 | - | 501 | WP_141405924.1 | MarR family transcriptional regulator | - |
| I6I08_RS11625 | 2753818..2754021 | - | 204 | WP_075250239.1 | helix-turn-helix transcriptional regulator | - |
| I6I08_RS11630 | 2754018..2754407 | - | 390 | WP_141405926.1 | hypothetical protein | - |
| I6I08_RS11635 | 2754517..2755035 | - | 519 | WP_141405928.1 | HXXEE domain-containing protein | - |
| I6I08_RS11650 | 2755529..2756026 | - | 498 | WP_029316099.1 | DUF3566 domain-containing protein | - |
| I6I08_RS11655 | 2756023..2758704 | - | 2682 | WP_141405929.1 | DNA gyrase subunit A | - |
| I6I08_RS11660 | 2758773..2760800 | - | 2028 | WP_141405931.1 | DNA topoisomerase (ATP-hydrolyzing) subunit B | - |
| I6I08_RS11665 | 2761127..2761804 | - | 678 | WP_198498117.1 | DUF721 domain-containing protein | - |
| I6I08_RS11670 | 2761797..2763014 | - | 1218 | WP_141405933.1 | DNA replication/repair protein RecF | - |
| I6I08_RS11675 | 2763028..2764158 | - | 1131 | WP_101588199.1 | DNA polymerase III subunit beta | - |
| I6I08_RS11680 | 2764814..2766484 | - | 1671 | WP_141405935.1 | chromosomal replication initiator protein DnaA | - |
| I6I08_RS11685 | 2767081..2767218 | + | 138 | WP_003788507.1 | 50S ribosomal protein L34 | - |
| I6I08_RS11690 | 2767220..2767588 | + | 369 | WP_003788509.1 | ribonuclease P protein component | - |
| I6I08_RS11695 | 2767612..2767896 | + | 285 | WP_070510270.1 | membrane protein insertion efficiency factor YidD | - |
| I6I08_RS11700 | 2767990..2769174 | + | 1185 | WP_075378087.1 | membrane protein insertase YidC | - |
| I6I08_RS11705 | 2769225..2769839 | + | 615 | WP_198498118.1 | single-stranded DNA-binding protein | - |
| I6I08_RS11710 | 2769842..2770486 | + | 645 | WP_141405937.1 | 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG | - |
| I6I08_RS11715 | 2770594..2771496 | + | 903 | WP_141405939.1 | ParA family protein | - |
| I6I08_RS11720 | 2771496..2773085 | + | 1590 | WP_141405941.1 | ParB/RepB/Spo0J family partition protein | - |
| I6I08_RS11725 | 2777684..2778631 | - | 948 | WP_075378083.1 | ATP-grasp domain-containing protein | - |
| I6I08_RS11730 | 2778640..2779953 | - | 1314 | WP_075414300.1 | PLP-dependent aminotransferase family protein | - |
| I6I08_RS11735 | 2780183..2781622 | - | 1440 | WP_141405943.1 | threonine synthase | - |
| I6I08_RS11740 | 2781872..2782198 | - | 327 | WP_003788529.1 | thioredoxin | - |
| I6I08_RS11745 | 2782307..2783233 | - | 927 | WP_101559258.1 | thioredoxin-disulfide reductase | - |
| I6I08_RS11750 | 2783321..2787616 | - | 4296 | WP_141405945.1 | hypothetical protein | - |
| I6I08_RS11755 | 2787613..2790090 | - | 2478 | WP_141405946.1 | hypothetical protein | - |
| I6I08_RS11760 | 2790087..2790596 | - | 510 | WP_003788538.1 | NUDIX hydrolase | - |
| I6I08_RS11765 | 2790800..2792287 | + | 1488 | WP_141405948.1 | CCA tRNA nucleotidyltransferase | - |
| I6I08_RS11770 | 2792298..2793497 | + | 1200 | WP_141405950.1 | Gfo/Idh/MocA family oxidoreductase | - |
| I6I08_RS11775 | 2793654..2795162 | + | 1509 | WP_141405952.1 | alpha-galactosidase | - |
| I6I08_RS11780 | 2795208..2796518 | - | 1311 | WP_141405954.1 | ATP-binding protein | - |
| I6I08_RS11785 | 2796908..2799697 | + | 2790 | WP_141405956.1 | type I-U CRISPR-associated helicase/endonuclease Cas3 | - |
| I6I08_RS11790 | 2799600..2800601 | + | 1002 | WP_141405958.1 | hypothetical protein | - |
| I6I08_RS11795 | 2800626..2801201 | + | 576 | WP_075378074.1 | type I-E CRISPR-associated protein Cas6/Cse3/CasE | - |
| I6I08_RS11800 | 2801266..2802477 | + | 1212 | WP_141405960.1 | type I-U CRISPR-associated protein Cas7 | - |
| I6I08_RS11805 | 2802470..2803786 | + | 1317 | WP_141405961.1 | type I-U CRISPR-associated protein Cas5/Cas6 | - |
| I6I08_RS11810 | 2805010..2806566 | - | 1557 | WP_141405963.1 | DUF4832 domain-containing protein | - |
| I6I08_RS11815 | 2806790..2807917 | + | 1128 | WP_198498185.1 | 3-phosphoserine/phosphohydroxythreonine transaminase | - |
| I6I08_RS11820 | 2808038..2809228 | + | 1191 | WP_141405966.1 | phosphoglycerate dehydrogenase | - |
| I6I08_RS11825 | 2809401..2810618 | - | 1218 | WP_141405968.1 | Fic family protein | - |
| I6I08_RS11830 | 2810872..2811636 | - | 765 | WP_141405969.1 | DUF4352 domain-containing protein | - |
| I6I08_RS11835 | 2812198..2813718 | + | 1521 | WP_141405970.1 | two-component sensor histidine kinase | - |
| I6I08_RS11840 | 2813852..2814613 | + | 762 | WP_141405972.1 | response regulator transcription factor | - |
| I6I08_RS11845 | 2815502..2817565 | - | 2064 | WP_141405974.1 | Stk1 family PASTA domain-containing Ser/Thr kinase | - |
| I6I08_RS11850 | 2817562..2818689 | - | 1128 | WP_075253675.1 | serine/threonine protein kinase | - |
| I6I08_RS11855 | 2818686..2820188 | - | 1503 | WP_003788592.1 | penicillin-binding protein 2 | - |
| I6I08_RS11860 | 2820185..2821882 | - | 1698 | WP_141405975.1 | FtsW/RodA/SpoVE family cell cycle protein | - |
| I6I08_RS11865 | 2821884..2823305 | - | 1422 | WP_141405977.1 | protein phosphatase 2C domain-containing protein | - |
| I6I08_RS11870 | 2823302..2823778 | - | 477 | WP_003788599.1 | FHA domain-containing protein | - |
| I6I08_RS11875 | 2823775..2824482 | - | 708 | WP_003788601.1 | DUF3662 domain-containing protein | - |
| I6I08_RS11885 | 2825115..2825669 | - | 555 | WP_141405979.1 | VanZ family protein | - |
| I6I08_RS11890 | 2825752..2826039 | - | 288 | WP_141405981.1 | YbdD/YjiX family protein | - |
| I6I08_RS11895 | 2826036..2828426 | - | 2391 | WP_141405983.1 | carbon starvation protein A | - |
| I6I08_RS11900 | 2828698..2830281 | + | 1584 | WP_141405985.1 | transporter | - |
| I6I08_RS11905 | 2830566..2830994 | - | 429 | WP_141405986.1 | carboxymuconolactone decarboxylase family protein | - |
| I6I08_RS11910 | 2830991..2831536 | - | 546 | WP_141405987.1 | MerR family transcriptional regulator | - |
| I6I08_RS11915 | 2831626..2831934 | + | 309 | WP_141405989.1 | thiamine-binding protein | - |
| I6I08_RS11920 | 2832044..2832787 | - | 744 | WP_141405991.1 | 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | - |
| I6I08_RS11925 | 2833146..2834099 | - | 954 | WP_141405993.1 | hypothetical protein | - |
| I6I08_RS11930 | 2834423..2835046 | - | 624 | WP_141405994.1 | TetR family transcriptional regulator | - |
| I6I08_RS11935 | 2835176..2837506 | + | 2331 | WP_141405996.1 | MMPL family transporter | - |
| I6I08_RS11940 | 2837942..2838910 | - | 969 | WP_003788621.1 | ATP-binding protein | - |
| I6I08_RS11945 | 2839348..2839830 | - | 483 | WP_009406873.1 | S-ribosylhomocysteine lyase | - |
| I6I08_RS11950 | 2839871..2840695 | + | 825 | WP_141405998.1 | alpha/beta hydrolase | - |
| I6I08_RS11955 | 2840886..2842184 | + | 1299 | WP_141406000.1 | AI-2E family transporter | - |
| I6I08_RS11960 | 2842458..2843405 | - | 948 | WP_141406002.1 | ROK family glucokinase | - |
| I6I08_RS11965 | 2843599..2844546 | - | 948 | WP_141406004.1 | thioredoxin domain-containing protein | - |
| I6I08_RS11970 | 2844770..2845267 | - | 498 | WP_141406006.1 | CrcB family protein | - |
| I6I08_RS11975 | 2845264..2845731 | - | 468 | WP_141406260.1 | CrcB family protein | - |
| I6I08_RS11980 | 2845939..2847660 | - | 1722 | WP_141406007.1 | DUF2079 domain-containing protein | - |
| I6I08_RS11985 | 2847741..2849207 | + | 1467 | WP_198498119.1 | amino acid permease | - |
| I6I08_RS11990 | 2849204..2850073 | + | 870 | WP_141406008.1 | inositol monophosphatase | - |
| I6I08_RS11995 | 2850219..2851508 | + | 1290 | WP_141406009.1 | ATP-binding protein | - |
| I6I08_RS12000 | 2851505..2852032 | + | 528 | WP_141406010.1 | hypothetical protein | - |
| I6I08_RS12005 | 2852110..2852283 | + | 174 | Protein_2342 | inositol monophosphatase | - |
| I6I08_RS12010 | 2853178..2854740 | + | 1563 | WP_141406014.1 | MFS transporter | - |
| I6I08_RS12015 | 2855522..2857408 | + | 1887 | WP_141406017.1 | alpha/beta hydrolase | - |
| I6I08_RS12020 | 2857535..2858671 | - | 1137 | WP_141406019.1 | SGNH/GDSL hydrolase family protein | - |
| I6I08_RS12025 | 2859089..2860257 | - | 1169 | Protein_2346 | ISAs1 family transposase | - |
| I6I08_RS12030 | 2860727..2861530 | - | 804 | WP_198498120.1 | transposase | - |
| I6I08_RS12035 | 2861536..2862141 | - | 606 | WP_198498121.1 | hypothetical protein | - |
| I6I08_RS12040 | 2862542..2865511 | - | 2970 | WP_141406020.1 | flippase-like domain-containing protein | - |
| I6I08_RS12045 | 2865670..2866323 | + | 654 | WP_141406022.1 | hypothetical protein | - |
| I6I08_RS12050 | 2866325..2866726 | + | 402 | WP_141406024.1 | transcriptional regulator | - |
| I6I08_RS12055 | 2866933..2867937 | + | 1005 | WP_141406026.1 | prolyl oligopeptidase family serine peptidase | - |
| I6I08_RS12060 | 2868151..2868885 | + | 735 | WP_141406027.1 | response regulator transcription factor | - |
| I6I08_RS12065 | 2869201..2869869 | - | 669 | WP_170198564.1 | response regulator transcription factor | - |
| I6I08_RS12070 | 2869866..2871041 | - | 1176 | WP_170198565.1 | hypothetical protein | - |
| I6I08_RS12075 | 2871462..2872301 | + | 840 | WP_198498122.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS12080 | 2872298..2873041 | + | 744 | WP_141406034.1 | ABC transporter permease | - |
| I6I08_RS12085 | 2873157..2876054 | - | 2898 | WP_141406035.1 | pullulanase-type alpha-1,6-glucosidase | - |
| I6I08_RS12090 | 2876489..2877871 | + | 1383 | WP_141406037.1 | replication-associated recombination protein A | - |
| I6I08_RS12095 | 2878096..2880687 | - | 2592 | WP_141406039.1 | (Fe-S)-binding protein | - |
| I6I08_RS12100 | 2881058..2881375 | - | 318 | WP_070510195.1 | DUF4235 domain-containing protein | - |
| I6I08_RS12105 | 2881806..2882144 | + | 339 | WP_075378933.1 | hypothetical protein | - |
| I6I08_RS12110 | 2882402..2882767 | - | 366 | WP_003788709.1 | hypothetical protein | - |
| I6I08_RS12115 | 2882849..2883298 | - | 450 | WP_070510191.1 | TetR/AcrR family transcriptional regulator | - |
| I6I08_RS12120 | 2883377..2884444 | - | 1068 | WP_141406040.1 | YdcF family protein | - |
| I6I08_RS12125 | 2884746..2885177 | - | 432 | WP_141406041.1 | helix-turn-helix transcriptional regulator | - |
| I6I08_RS12130 | 2885289..2886116 | + | 828 | WP_141406043.1 | NAD(P)H-binding protein | - |
| I6I08_RS12135 | 2886485..2887582 | + | 1098 | WP_075375411.1 | thiamine ABC transporter substrate-binding protein | - |
| I6I08_RS12140 | 2887546..2889471 | + | 1926 | WP_198498123.1 | iron ABC transporter permease | - |
| I6I08_RS12145 | 2889468..2890616 | + | 1149 | WP_141406047.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS12150 | 2890829..2891866 | + | 1038 | WP_141406049.1 | ABC transporter permease | - |
| I6I08_RS12155 | 2891863..2892849 | + | 987 | WP_141406051.1 | ABC transporter permease | - |
| I6I08_RS12160 | 2892953..2894629 | + | 1677 | WP_141406053.1 | ABC transporter substrate-binding protein | - |
| I6I08_RS12165 | 2894626..2896596 | + | 1971 | WP_075378939.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS12170 | 2896933..2900595 | + | 3663 | WP_075378940.1 | DUF4011 domain-containing protein | - |
| I6I08_RS12175 | 2901121..2902176 | + | 1056 | WP_040322109.1 | hypothetical protein | - |
| I6I08_RS12180 | 2902338..2902829 | + | 492 | WP_141406054.1 | hypothetical protein | - |
| I6I08_RS12185 | 2902953..2903393 | + | 441 | WP_141406055.1 | YbjN domain-containing protein | - |
| I6I08_RS12190 | 2903393..2904244 | + | 852 | WP_101587623.1 | hypothetical protein | - |
| I6I08_RS12195 | 2904634..2907669 | + | 3036 | WP_141406057.1 | hypothetical protein | - |
| I6I08_RS12200 | 2907984..2908850 | + | 867 | WP_101587627.1 | glutathione transferase | - |
| I6I08_RS12205 | 2908923..2909438 | - | 516 | WP_070513752.1 | GNAT family N-acetyltransferase | - |
| I6I08_RS12210 | 2909435..2909740 | - | 306 | WP_070513754.1 | DUF1778 domain-containing protein | - |
| I6I08_RS12215 | 2909931..2911277 | - | 1347 | WP_070513756.1 | DUF4921 family protein | - |
| I6I08_RS12220 | 2911368..2911808 | - | 441 | WP_075378948.1 | VapC toxin family PIN domain ribonuclease | - |
| I6I08_RS12225 | 2911795..2912025 | - | 231 | WP_040322114.1 | hypothetical protein | - |
| I6I08_RS12230 | 2912219..2913829 | + | 1611 | WP_141406059.1 | cation:proton antiporter | - |
| I6I08_RS12235 | 2914027..2914686 | - | 660 | WP_141406262.1 | GPP34 family phosphoprotein | - |
| I6I08_RS12240 | 2914942..2918589 | + | 3648 | WP_141406060.1 | DEAD/DEAH box helicase | - |
| I6I08_RS12245 | 2919103..2919354 | + | 252 | WP_020992132.1 | DUF4244 domain-containing protein | - |
| I6I08_RS12250 | 2919376..2919561 | + | 186 | WP_141406062.1 | hypothetical protein | - |
| I6I08_RS12255 | 2919555..2919869 | + | 315 | WP_043538407.1 | hypothetical protein | - |
| I6I08_RS12260 | 2920004..2920408 | + | 405 | WP_141406263.1 | flp pilus-assembly TadE/G-like family protein | - |
| I6I08_RS12265 | 2920456..2922642 | - | 2187 | WP_141406264.1 | ABC transporter ATP-binding protein/permease | - |
| I6I08_RS12270 | 2922663..2924396 | - | 1734 | WP_141406063.1 | ABC transporter ATP-binding protein/permease | - |
| I6I08_RS12275 | 2924594..2927464 | - | 2871 | WP_141406065.1 | DUF1998 domain-containing protein | - |
| I6I08_RS12280 | 2928042..2928638 | - | 597 | WP_141406067.1 | zinc transporter | - |
| I6I08_RS12285 | 2928860..2929498 | - | 639 | WP_141406265.1 | hypothetical protein | - |
| I6I08_RS12290 | 2929908..2931698 | - | 1791 | WP_141406068.1 | M20/M25/M40 family metallo-hydrolase | - |
| I6I08_RS12295 | 2931842..2932042 | - | 201 | Protein_2400 | serine hydrolase | - |
| I6I08_RS12300 | 2932627..2933529 | + | 903 | WP_141406070.1 | hypothetical protein | - |
| I6I08_RS12305 | 2934094..2936073 | + | 1980 | WP_075378957.1 | ribonucleoside triphosphate reductase | - |
| I6I08_RS12310 | 2936341..2937051 | + | 711 | WP_198498186.1 | anaerobic ribonucleoside-triphosphate reductase activating protein | - |
| I6I08_RS12315 | 2937358..2937915 | + | 558 | WP_198498124.1 | hypothetical protein | - |
| I6I08_RS12320 | 2937887..2938498 | - | 612 | WP_075373700.1 | TetR/AcrR family transcriptional regulator | - |
| I6I08_RS12325 | 2938619..2940232 | + | 1614 | WP_141406072.1 | MFS transporter | - |
| I6I08_RS12330 | 2940353..2945071 | + | 4719 | WP_141406074.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| I6I08_RS12335 | 2945074..2947614 | + | 2541 | WP_075378961.1 | hypothetical protein | - |
| I6I08_RS12340 | 2947725..2948276 | - | 552 | WP_178387847.1 | TetR/AcrR family transcriptional regulator | - |
| I6I08_RS12345 | 2948555..2949010 | + | 456 | WP_075374190.1 | hypothetical protein | - |
| I6I08_RS12350 | 2949238..2950989 | + | 1752 | WP_075374191.1 | catalase | - |
| I6I08_RS12355 | 2951115..2951501 | + | 387 | WP_075378963.1 | hypothetical protein | - |
| I6I08_RS12360 | 2951624..2952691 | + | 1068 | Protein_2413 | family 16 glycosylhydrolase | - |
| I6I08_RS12365 | 2952865..2953503 | - | 639 | WP_075375360.1 | malonic semialdehyde reductase | - |
| I6I08_RS12370 | 2953843..2954550 | - | 708 | WP_075375361.1 | hypothetical protein | - |
| I6I08_RS12375 | 2954547..2954873 | - | 327 | WP_008732099.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| I6I08_RS12380 | 2954957..2955742 | - | 786 | WP_141406076.1 | CPBP family intramembrane metalloprotease | - |
| I6I08_RS12385 | 2956205..2956603 | + | 399 | WP_075375367.1 | excalibur calcium-binding domain-containing protein | - |
| I6I08_RS12390 | 2956871..2957320 | + | 450 | WP_141406267.1 | excalibur calcium-binding domain-containing protein | - |
| I6I08_RS12395 | 2957579..2957953 | - | 375 | WP_198498187.1 | very short patch repair endonuclease | - |
| I6I08_RS12400 | 2958089..2959429 | - | 1341 | WP_198498188.1 | DNA (cytosine-5-)-methyltransferase | - |
| I6I08_RS12405 | 2960026..2962302 | + | 2277 | WP_141406080.1 | DUF262 domain-containing protein | - |
| I6I08_RS12410 | 2962307..2965081 | + | 2775 | WP_141406081.1 | hypothetical protein | - |
| I6I08_RS12415 | 2965084..2966148 | + | 1065 | WP_141406082.1 | PD-(D/E)XK motif protein | - |
| I6I08_RS12420 | 2966225..2966968 | - | 744 | WP_141406084.1 | cupin | - |
| I6I08_RS12425 | 2966965..2967774 | - | 810 | WP_141406086.1 | ABC transporter | - |
| I6I08_RS12430 | 2967771..2968535 | - | 765 | WP_141406088.1 | ATP-binding cassette domain-containing protein | - |
| I6I08_RS12435 | 2968666..2969727 | + | 1062 | WP_141406089.1 | two-component sensor histidine kinase | - |
| I6I08_RS12440 | 2969724..2970455 | + | 732 | WP_141406091.1 | response regulator transcription factor | - |
| I6I08_RS12445 | 2970593..2971771 | - | 1179 | WP_141406093.1 | bifunctional glycosyltransferase family 2/GtrA family protein | - |
| I6I08_RS12450 | 2971773..2972804 | - | 1032 | WP_141406095.1 | phosphodiester glycosidase family protein | - |
| I6I08_RS12455 | 2973052..2973255 | + | 204 | WP_075377918.1 | hypothetical protein | - |
| I6I08_RS12460 | 2973474..2974646 | + | 1173 | WP_141406096.1 | ABC transporter substrate-binding protein | - |
| I6I08_RS12465 | 2974646..2975821 | + | 1176 | WP_141406098.1 | iron ABC transporter permease | - |
| I6I08_RS12470 | 2975818..2976576 | + | 759 | WP_060957173.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS12475 | 2976594..2977691 | - | 1098 | WP_141406099.1 | tetratricopeptide repeat protein | - |
| I6I08_RS12480 | 2977664..2979061 | - | 1398 | WP_141406101.1 | AAA family ATPase | - |
| I6I08_RS12485 | 2979192..2980499 | + | 1308 | WP_075377861.1 | multidrug effflux MFS transporter | - |
| I6I08_RS12490 | 2980523..2980936 | - | 414 | WP_141406103.1 | serine/threonine protein phosphatase | - |
| I6I08_RS12495 | 2981013..2981291 | - | 279 | WP_075377863.1 | hypothetical protein | - |
| I6I08_RS12500 | 2981288..2981515 | - | 228 | WP_009407640.1 | hypothetical protein | - |
| I6I08_RS12505 | 2982306..2984165 | + | 1860 | WP_009407705.1 | molecular chaperone DnaK | - |
| I6I08_RS12510 | 2984162..2984788 | + | 627 | WP_075377864.1 | nucleotide exchange factor GrpE | - |
| I6I08_RS12515 | 2984983..2986026 | + | 1044 | WP_141406105.1 | DnaJ domain-containing protein | - |
| I6I08_RS12520 | 2986023..2986519 | + | 497 | Protein_2445 | helix-turn-helix transcriptional regulator | - |
| I6I08_RS12525 | 2986736..2988187 | + | 1452 | WP_141406109.1 | DUF418 domain-containing protein | - |
| I6I08_RS12530 | 2988312..2989676 | + | 1365 | WP_141406111.1 | DUF418 domain-containing protein | - |
| I6I08_RS12535 | 2989837..2991165 | + | 1329 | WP_141406112.1 | DUF418 domain-containing protein | - |
| I6I08_RS12540 | 2991425..2991880 | + | 456 | WP_141406113.1 | collagen-like protein | - |
| I6I08_RS12545 | 2991961..2993226 | - | 1266 | WP_198498125.1 | HAMP domain-containing protein | - |
| I6I08_RS12550 | 2993223..2993882 | - | 660 | WP_075373865.1 | response regulator transcription factor | - |
| I6I08_RS12555 | 2994061..2994528 | + | 468 | WP_009407646.1 | hypothetical protein | - |
| I6I08_RS12560 | 2994612..2995787 | + | 1176 | WP_141406115.1 | peptidoglycan-binding protein | - |
| I6I08_RS12565 | 2995784..2996497 | + | 714 | WP_003788873.1 | ABC transporter ATP-binding protein | - |
| I6I08_RS12570 | 2996472..2997725 | + | 1254 | WP_083303305.1 | ABC transporter permease | - |
| I6I08_RS12575 | 2997947..2998129 | - | 183 | WP_009407609.1 | antitoxin | - |
| I6I08_RS12580 | 2998495..2998968 | - | 474 | WP_141406116.1 | MmcQ/YjbR family DNA-binding protein | - |
| I6I08_RS12585 | 2999247..2999456 | - | 210 | WP_141406118.1 | helix-turn-helix transcriptional regulator | - |
| I6I08_RS12590 | 2999453..3000226 | - | 774 | WP_141406120.1 | hypothetical protein | - |
| I6I08_RS12595 | 3000548..3001261 | - | 714 | WP_141406121.1 | hypothetical protein | - |
| I6I08_RS12600 | 3001405..3002091 | - | 687 | WP_170198567.1 | hypothetical protein | - |
| I6I08_RS12605 | 3002336..3005017 | + | 2682 | WP_141406125.1 | ATP-dependent chaperone ClpB | - |
| I6I08_RS12610 | 3005175..3006206 | - | 1032 | WP_141406127.1 | DUF3152 domain-containing protein | - |
| I6I08_RS12615 | 3006292..3006849 | - | 558 | WP_141406270.1 | RES family NAD+ phosphorylase | - |
| I6I08_RS12620 | 3006918..3007508 | - | 591 | WP_141406128.1 | hypothetical protein | - |
| I6I08_RS12625 | 3008046..3008735 | + | 690 | WP_003788897.1 | TetR/AcrR family transcriptional regulator; helix-turn-helix transcriptional regulator | - |
| I6I08_RS12630 | 3008893..3009573 | - | 681 | WP_141406130.1 | HAD family phosphatase | - |
| I6I08_RS12635 | 3009772..3010782 | + | 1011 | WP_141406131.1 | LacI family transcriptional regulator | - |
| I6I08_RS12640 | 3011068..3013899 | - | 2832 | WP_141406133.1 | GH32 C-terminal domain-containing protein | - |
| I6I08_RS12645 | 3014145..3014441 | + | 297 | WP_075414517.1 | PspC domain-containing protein | - |
| I6I08_RS12650 | 3014887..3017145 | + | 2259 | WP_198498126.1 | NAD(+) synthase | - |
| I6I08_RS12655 | 3017448..3017888 | + | 441 | WP_009407652.1 | PTS sugar transporter subunit IIA | - |
| I6I08_RS12660 | 3017888..3018379 | + | 492 | WP_009407462.1 | PTS sugar transporter subunit IIB | - |
| I6I08_RS12665 | 3018489..3019421 | + | 933 | WP_003788909.1 | PTS mannose/fructose/sorbose transporter subunit IIC | - |
| I6I08_RS12670 | 3019443..3020300 | + | 858 | WP_009407764.1 | PTS mannose transporter subunit IID | - |
| I6I08_RS12675 | 3020525..3021307 | + | 783 | WP_141406135.1 | Cof-type HAD-IIB family hydrolase | - |
| I6I08_RS12680 | 3021300..3021899 | + | 600 | WP_141406137.1 | hypothetical protein | - |
| I6I08_RS12685 | 3021982..3022875 | + | 894 | WP_141406138.1 | Cof-type HAD-IIB family hydrolase | - |
| I6I08_RS12690 | 3023022..3023837 | + | 816 | WP_141406140.1 | Cof-type HAD-IIB family hydrolase | - |
| I6I08_RS12695 | 3024023..3024469 | - | 447 | WP_141406142.1 | GNAT family N-acetyltransferase | - |
| I6I08_RS12700 | 3024822..3026165 | - | 1344 | WP_141406272.1 | serpin | - |
| I6I08_RS12705 | 3026487..3027851 | + | 1365 | WP_141406143.1 | PAS domain-containing protein | - |
| I6I08_RS12710 | 3027860..3029086 | - | 1227 | WP_141406145.1 | methyltransferase domain-containing protein | - |
| I6I08_RS12720 | 3029372..3030301 | - | 930 | WP_141406146.1 | thioredoxin domain-containing protein | - |
| I6I08_RS12725 | 3030542..3030997 | + | 456 | WP_141406273.1 | hypothetical protein | - |
| I6I08_RS12730 | 3031409..3031831 | + | 423 | WP_141406274.1 | hypothetical protein | - |
| I6I08_RS12735 | 3031928..3033979 | - | 2052 | WP_141406148.1 | serine/threonine protein kinase | - |
| I6I08_RS12740 | 3034334..3035461 | + | 1128 | WP_141406149.1 | sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | - |
| I6I08_RS12745 | 3035645..3037021 | + | 1377 | WP_141406151.1 | DUF4032 domain-containing protein | - |
| I6I08_RS12750 | 3037133..3037612 | + | 480 | WP_141406153.1 | hypothetical protein | - |
| I6I08_RS12755 | 3037653..3038117 | + | 465 | WP_141406154.1 | hypothetical protein | - |
| I6I08_RS12760 | 3038314..3039555 | - | 1242 | WP_141406156.1 | hypothetical protein | - |
| I6I08_RS12765 | 3039725..3040723 | - | 999 | WP_141406158.1 | 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB | - |
| I6I08_RS12770 | 3040787..3042379 | - | 1593 | WP_141406160.1 | cysteine--tRNA ligase | - |
| I6I08_RS12775 | 3042505..3043029 | - | 525 | WP_075377924.1 | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | - |
| I6I08_RS12780 | 3043323..3043790 | + | 468 | WP_009407550.1 | hypothetical protein | - |
| I6I08_RS12785 | 3043857..3044534 | - | 678 | WP_075377902.1 | uracil-DNA glycosylase | - |
| I6I08_RS12790 | 3044653..3045291 | + | 639 | WP_101587766.1 | LytR C-terminal domain-containing protein | - |
| I6I08_RS12795 | 3045298..3046785 | + | 1488 | WP_141406161.1 | glycoside hydrolase family 15 | - |
| I6I08_RS12800 | 3047101..3048723 | + | 1623 | WP_003788944.1 | chaperonin GroEL | - |
| I6I08_RS12805 | 3048965..3049324 | - | 360 | WP_020992166.1 | WXG100 family type VII secretion target | - |
| I6I08_RS12810 | 3049530..3050939 | - | 1410 | WP_141406163.1 | hypothetical protein | - |
| I6I08_RS12815 | 3051081..3052679 | - | 1599 | WP_020992167.1 | HAMP domain-containing histidine kinase | - |
| I6I08_RS12820 | 3052679..3053416 | - | 738 | WP_075377905.1 | response regulator transcription factor | - |
| I6I08_RS12825 | 3053660..3054262 | - | 603 | WP_075377906.1 | NYN domain-containing protein | - |
| I6I08_RS12830 | 3054668..3055516 | - | 849 | WP_075377907.1 | PspA/IM30 family protein | - |
| I6I08_RS12835 | 3055737..3057914 | - | 2178 | WP_141406165.1 | TPM domain-containing protein | - |
| I6I08_RS12840 | 3058027..3058935 | + | 909 | WP_141406167.1 | type 1 glutamine amidotransferase | - |
| I6I08_RS12845 | 3059027..3060721 | - | 1695 | WP_141406168.1 | DEAD/DEAH box helicase | - |
| I6I08_RS12850 | 3061163..3061981 | - | 819 | WP_065361617.1 | AAA family ATPase | - |
| I6I08_RS12855 | 3061978..3063192 | - | 1215 | WP_141406170.1 | Mu transposase C-terminal domain-containing protein | - |
| I6I08_RS12860 | 3063200..3063796 | - | 597 | WP_065361615.1 | recombinase family protein | - |
| I6I08_RS12865 | 3064133..3065557 | - | 1425 | WP_065361614.1 | mercury(II) reductase | - |
| I6I08_RS12870 | 3065665..3066054 | + | 390 | WP_010613285.1 | heavy metal-responsive transcriptional regulator | - |
| I6I08_RS12875 | 3066461..3069043 | + | 2583 | WP_141406172.1 | helicase-associated domain-containing protein | - |
| I6I08_RS12880 | 3069406..3070890 | + | 1485 | WP_141406275.1 | DUF3027 domain-containing protein | - |
| I6I08_RS12885 | 3070915..3071751 | - | 837 | WP_141406174.1 | uracil-DNA glycosylase | - |
| I6I08_RS12890 | 3071819..3076852 | - | 5034 | WP_141406175.1 | DEAD/DEAH box helicase | - |
| I6I08_RS12895 | 3076917..3078440 | + | 1524 | WP_141406177.1 | NCS2 family permease | - |
| I6I08_RS12900 | 3078778..3079407 | - | 630 | WP_141406178.1 | hypothetical protein | - |
| I6I08_RS12905 | 3079449..3081845 | - | 2397 | WP_141406180.1 | hypothetical protein | - |
| I6I08_RS12910 | 3082475..3083818 | + | 1344 | WP_178389510.1 | MFS transporter | - |
| I6I08_RS12915 | 3084082..3084753 | + | 672 | WP_003788968.1 | metal-dependent transcriptional regulator | - |
| I6I08_RS12920 | 3085369..3086187 | + | 819 | WP_003788969.1 | C40 family peptidase | - |
| I6I08_RS12925 | 3086415..3087353 | + | 939 | WP_003788970.1 | universal stress protein | - |
| I6I08_RS12935 | 3087645..3088679 | - | 1035 | WP_141406182.1 | site-specific integrase | - |
| I6I08_RS12940 | 3088676..3088933 | - | 258 | WP_141406183.1 | hypothetical protein | - |
| I6I08_RS12945 | 3088968..3090479 | - | 1512 | WP_141406185.1 | hypothetical protein | - |
| I6I08_RS12950 | 3090479..3090913 | - | 435 | WP_141406186.1 | hypothetical protein | - |
| I6I08_RS12955 | 3093728..3098041 | + | 4314 | WP_141406188.1 | DNA helicase | - |
| I6I08_RS12960 | 3098070..3098420 | + | 351 | WP_141406189.1 | hypothetical protein | - |
| I6I08_RS12965 | 3098512..3098952 | - | 441 | WP_141406190.1 | large conductance mechanosensitive channel protein MscL | - |
| I6I08_RS12970 | 3099055..3099840 | - | 786 | WP_141406276.1 | SAF domain-containing protein | - |
| I6I08_RS12975 | 3100139..3100801 | - | 663 | WP_141406192.1 | 5-formyltetrahydrofolate cyclo-ligase | - |
| I6I08_RS12980 | 3100897..3102108 | + | 1212 | WP_141406194.1 | molybdopterin molybdotransferase MoeA | - |
| I6I08_RS12985 | 3102108..3102854 | + | 747 | WP_141406196.1 | GNAT family N-acetyltransferase | - |
| I6I08_RS12990 | 3103063..3104727 | + | 1665 | WP_141406198.1 | hypothetical protein | - |
| I6I08_RS13000 | 3104903..3105529 | - | 627 | WP_141406200.1 | hypothetical protein | - |
| I6I08_RS13005 | 3106265..3107062 | - | 798 | WP_170198570.1 | IS3 family transposase | - |
| I6I08_RS13010 | 3107059..3107343 | - | 285 | WP_170198571.1 | transposase | - |
| I6I08_RS13015 | 3107354..3107815 | - | 462 | WP_141406206.1 | recombinase family protein | - |
| I6I08_RS13020 | 3108158..3108778 | - | 621 | WP_141406208.1 | hypothetical protein | - |
| I6I08_RS13025 | 3108777..3109016 | + | 240 | WP_198498127.1 | hypothetical protein | - |
| I6I08_RS13030 | 3109035..3109319 | + | 285 | WP_198498128.1 | transposase | - |
| I6I08_RS13035 | 3109469..3109756 | + | 288 | WP_010614278.1 | IS3 family transposase | - |
| I6I08_RS13040 | 3109805..3110200 | + | 396 | WP_198498189.1 | DDE-type integrase/transposase/recombinase | - |
| I6I08_RS13045 | 3110960..3112165 | + | 1206 | WP_170198572.1 | hypothetical protein | - |
| I6I08_RS13050 | 3112655..3114604 | + | 1950 | WP_039775557.1 | DUF3732 domain-containing protein | - |
| I6I08_RS13055 | 3114939..3115064 | - | 126 | WP_010614284.1 | hypothetical protein | - |
| I6I08_RS13060 | 3115064..3115399 | - | 336 | WP_170198573.1 | transposase | - |
| I6I08_RS13065 | 3115524..3116312 | - | 789 | WP_170198574.1 | transposase | - |
| I6I08_RS13070 | 3117600..3118688 | + | 1089 | WP_141406216.1 | hypothetical protein | - |
| I6I08_RS13075 | 3119023..3119181 | + | 159 | WP_010614290.1 | hypothetical protein | - |
| I6I08_RS13080 | 3119556..3120821 | + | 1266 | WP_141406217.1 | polysaccharide deacetylase family protein | - |
| I6I08_RS13085 | 3120877..3122421 | + | 1545 | WP_141406219.1 | glycosyltransferase family 2 protein | - |
| I6I08_RS13090 | 3122602..3122928 | - | 327 | WP_009407650.1 | helix-turn-helix domain-containing protein | - |
| I6I08_RS13095 | 3123056..3124285 | + | 1230 | WP_075379505.1 | MFS transporter | - |
| I6I08_RS13100 | 3124407..3125297 | + | 891 | WP_198498129.1 | NAD(P)-dependent oxidoreductase | - |
| I6I08_RS13105 | 3125456..3127450 | + | 1995 | WP_141406221.1 | oligopeptide transporter, OPT family | - |
| I6I08_RS13110 | 3127565..3128332 | + | 768 | WP_141406223.1 | ROK family protein | - |
| I6I08_RS13130 | 3134641..3135171 | + | 531 | Protein_2561 | NADH-flavin reductase | - |
| I6I08_RS13135 | 3135124..3137319 | - | 2196 | WP_141406404.1 | phospholipid carrier-dependent glycosyltransferase | - |
| I6I08_RS13140 | 3137373..3138302 | + | 930 | WP_141406405.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
| I6I08_RS13145 | 3138347..3138949 | + | 603 | WP_070510127.1 | isochorismatase family protein | - |
| I6I08_RS13150 | 3139071..3140138 | - | 1068 | WP_141406406.1 | hypothetical protein | - |
| I6I08_RS13155 | 3140398..3142245 | + | 1848 | WP_141406407.1 | methionine--tRNA ligase | - |
| I6I08_RS13160 | 3142252..3143178 | + | 927 | WP_141406408.1 | TatD family hydrolase | - |
| I6I08_RS13165 | 3143499..3144521 | + | 1023 | WP_141406409.1 | G5 domain-containing protein | - |
| I6I08_RS13170 | 3144691..3145617 | + | 927 | WP_141406410.1 | resuscitation-promoting factor | - |
| I6I08_RS13175 | 3145737..3146840 | + | 1104 | WP_141406411.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
| I6I08_RS13180 | 3146837..3147823 | + | 987 | WP_141406412.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| I6I08_RS13185 | 3147823..3149733 | + | 1911 | WP_141406413.1 | ATP-binding cassette domain-containing protein | - |
| I6I08_RS13190 | 3149866..3150411 | - | 546 | WP_003780678.1 | hypothetical protein | - |
| I6I08_RS13195 | 3150509..3151222 | + | 714 | WP_198498130.1 | FHA domain-containing protein | - |
| I6I08_RS13200 | 3151231..3153393 | + | 2163 | WP_141406414.1 | FHA domain-containing protein | - |
| I6I08_RS13205 | 3153393..3154859 | + | 1467 | WP_141406415.1 | serine/threonine protein kinase | - |
| I6I08_RS13210 | 3154987..3158355 | - | 3369 | WP_141406416.1 | RDD family protein | - |
| I6I08_RS13215 | 3158352..3160937 | - | 2586 | WP_141406417.1 | transglutaminase domain-containing protein | - |
| I6I08_RS13220 | 3160934..3162313 | - | 1380 | WP_070510086.1 | DUF58 domain-containing protein | - |
| I6I08_RS13225 | 3162319..3163284 | - | 966 | WP_003787581.1 | MoxR family ATPase | - |
| I6I08_RS13230 | 3163365..3169655 | - | 6291 | WP_141406418.1 | tandem-95 repeat protein | - |
| I6I08_RS13235 | 3169652..3170092 | - | 441 | WP_009407724.1 | adenylyltransferase/cytidyltransferase family protein | - |
| I6I08_RS13240 | 3170092..3171549 | - | 1458 | WP_141406419.1 | sugar transferase | - |
| I6I08_RS13245 | 3172268..3173527 | + | 1260 | WP_141406650.1 | oligosaccharide flippase family protein | - |
| I6I08_RS13250 | 3173697..3174431 | + | 735 | WP_070510083.1 | CDP-alcohol phosphatidyltransferase family protein | - |
| I6I08_RS13255 | 3174555..3175460 | + | 906 | WP_141406420.1 | hypothetical protein | - |
| I6I08_RS13260 | 3175549..3176724 | - | 1176 | WP_141406421.1 | glycosyltransferase family 4 protein | - |
| I6I08_RS13265 | 3176721..3177854 | - | 1134 | WP_141406651.1 | DUF1972 domain-containing protein | - |
| I6I08_RS13270 | 3178569..3180134 | + | 1566 | WP_141406422.1 | hypothetical protein | - |
| I6I08_RS13275 | 3180296..3180964 | + | 669 | WP_075379424.1 | hypothetical protein | - |
| I6I08_RS13280 | 3181417..3184500 | + | 3084 | WP_141406423.1 | LamG domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11315.74 Da Isoelectric Point: 9.5390
>T183844 WP_141406424.1 NZ_CP066060:162-452 [Actinomyces oris]
VSTYRLTPAARRDLSRIWDYSEERWGLRQAEVYLRNLQTCLERLADDPRRGHPRDEVRPGYRSRAVGSHVVFYVISDGGV
DVIRVLHQRMDPDRHV
VSTYRLTPAARRDLSRIWDYSEERWGLRQAEVYLRNLQTCLERLADDPRRGHPRDEVRPGYRSRAVGSHVVFYVISDGGV
DVIRVLHQRMDPDRHV
Download Length: 291 bp
>T183844 NZ_CP087191:c1439065-1438196 [Pseudomonas wadenswilerensis]
ATGTTGCACGCCACCGATCACGCGCTCGCCGCCCTTGAGGCCCAGTTGCAGCAGCGCTTTCCCCAGCGCCTGGTGCCACT
GGCCGGCGGCGCCCAGGCGATCCGCGAAGCCGGGCACGGGCCTGCCATCGTGCTGCTGCATGGCATTGGCTCGGGCGCTG
CGTCCTGGCTGCAGGTGGCGCTGCAACTGAGCCCCCACGCCCGGGTGATTGCCTGGGATGCACCGGGCTATGGCGACTCA
AGCCCGCTGGCCGCCCCTGCACCGCAAGCGGCGGACTATGCCCGGCGCCTGCTGCAATTGCTCGACGCGCTGCACATCGA
CGACTGCGTGCTGGTCGGCCATTCCCTGGGCGCTCTCAGCGCCGCGGCGTTGACCCATCGGCAGCCGCAACGGGTGCGCC
GCCTGGTGCTGATCAGCCCGGCCCGTGGCTATGGCGACCCGGCCCGGGCCGAGCAGGCCCGGCAGGTGCGCAGCCAACGC
CTGCACAACCTCGAACAGCTGGGCATCAGCCAGATGGCCCGCCAGCGCAGCGCCCACATGCTCTCGCCAACGGCCAGCAG
CGATGCCCGCGCCTGGGTGCAATGGAACATGGCGCGCCTGCTGCCCCAGGGTTATCGCCAGGCCATCGAGCTGCTGTGCG
GCGATGACCTGCTGCGCTACGCCGCCCTGGCCGTGCCCTGCGACGTTTACTGCGGCGCCGCCGACAGCATCACCCGCCCT
GAGGACTGCCAGGCCCTGGCCAAGGCCCTGGGGGCAGCGTTCGCGTTGATTACCGAGGCCGGCCACGCCAGCCCGATCGA
ACAACCCGAGGCCGTGGCAAGCCTGCTTGCCCGAGCCCTCGAAGCCTCTCTGACAGGTACTGCGCTATGA
ATGTTGCACGCCACCGATCACGCGCTCGCCGCCCTTGAGGCCCAGTTGCAGCAGCGCTTTCCCCAGCGCCTGGTGCCACT
GGCCGGCGGCGCCCAGGCGATCCGCGAAGCCGGGCACGGGCCTGCCATCGTGCTGCTGCATGGCATTGGCTCGGGCGCTG
CGTCCTGGCTGCAGGTGGCGCTGCAACTGAGCCCCCACGCCCGGGTGATTGCCTGGGATGCACCGGGCTATGGCGACTCA
AGCCCGCTGGCCGCCCCTGCACCGCAAGCGGCGGACTATGCCCGGCGCCTGCTGCAATTGCTCGACGCGCTGCACATCGA
CGACTGCGTGCTGGTCGGCCATTCCCTGGGCGCTCTCAGCGCCGCGGCGTTGACCCATCGGCAGCCGCAACGGGTGCGCC
GCCTGGTGCTGATCAGCCCGGCCCGTGGCTATGGCGACCCGGCCCGGGCCGAGCAGGCCCGGCAGGTGCGCAGCCAACGC
CTGCACAACCTCGAACAGCTGGGCATCAGCCAGATGGCCCGCCAGCGCAGCGCCCACATGCTCTCGCCAACGGCCAGCAG
CGATGCCCGCGCCTGGGTGCAATGGAACATGGCGCGCCTGCTGCCCCAGGGTTATCGCCAGGCCATCGAGCTGCTGTGCG
GCGATGACCTGCTGCGCTACGCCGCCCTGGCCGTGCCCTGCGACGTTTACTGCGGCGCCGCCGACAGCATCACCCGCCCT
GAGGACTGCCAGGCCCTGGCCAAGGCCCTGGGGGCAGCGTTCGCGTTGATTACCGAGGCCGGCCACGCCAGCCCGATCGA
ACAACCCGAGGCCGTGGCAAGCCTGCTTGCCCGAGCCCTCGAAGCCTCTCTGACAGGTACTGCGCTATGA
Antitoxin
Download Length: -1061492.6666667 a.a. Molecular weight: 30455.85 Da Isoelectric Point: 6.4973
>AT183844 WP_075379422.1 NZ_CP066060:3184644-165 [Actinomyces oris]
Download Length: -3184478 bp
>AT183844 NZ_CP087191:c1438199-1437372 [Pseudomonas wadenswilerensis]
ATGAATGATTCGGATCTGTTGAAAGACAACCAGGACAAGTACATCGTCCCCGGCCTTGAGCGCGGCCTGTTGCTGCTCTG
TGAATTCAGCCGGCAAAACCGCACCCTCACCGCACCGGAACTGGCGCGGCGTCTGGAGCTGCCGCGCTCGACCATCTTCC
GCCTGCTGACCACCCTGGAAACCATGGGCTTCGTCACCCGCAGCGGCAACGAGTACCGCCTGGGCATGTCGGTACTGCGC
CTGGGCTTCGAATACCTGGCCTCGCTGGAACTGACCGAGCTCGGTCAGCCGCTGCTGGCGCGGCTGTGCGATCACCTTAA
TTACCCGAGCAACCTGGTGGTGCGTGACGGTCGCTCGATCGTCTACGTGGCCAAGGTTTCGCCACCGTCGGTGTTCTCCA
GCGCCGTCAACGTCGGCACCCGCCTGCCGGCCCACGCCACCGTGCTGGGACGCATCCTGCTCGAAGACCTGAGCCTGGCC
GAGCTGCGCGAGCTGTACCCGGAAGAACACCTGGAACAGCACTCGCCGTGCACGCCGAAAACCGTGCTGGAGCTGTTCGA
CCTGGTGCAAAGCGACCGTCAGCGCGGCTATGTCAGCGGCGAAGGTTTCTTCGAGTCGTCGATCTCGACCATCGCCGCCC
CGGTGCGCGATCACAGTGGCCGGGTGGTTGCCGCCATGGGCGTGACCATTCCCACCGTGCAGGTTGGTCACATCAATTTT
GACGGCTTACTCGGCCATGTCCGTGGCAGCGCCGACGAGCTGTCGCGCCTGCTCAACTACACCCCGCACGCAGGCTCCAG
CCGCGTCACCGCGCTGATGAGGGACTGA
ATGAATGATTCGGATCTGTTGAAAGACAACCAGGACAAGTACATCGTCCCCGGCCTTGAGCGCGGCCTGTTGCTGCTCTG
TGAATTCAGCCGGCAAAACCGCACCCTCACCGCACCGGAACTGGCGCGGCGTCTGGAGCTGCCGCGCTCGACCATCTTCC
GCCTGCTGACCACCCTGGAAACCATGGGCTTCGTCACCCGCAGCGGCAACGAGTACCGCCTGGGCATGTCGGTACTGCGC
CTGGGCTTCGAATACCTGGCCTCGCTGGAACTGACCGAGCTCGGTCAGCCGCTGCTGGCGCGGCTGTGCGATCACCTTAA
TTACCCGAGCAACCTGGTGGTGCGTGACGGTCGCTCGATCGTCTACGTGGCCAAGGTTTCGCCACCGTCGGTGTTCTCCA
GCGCCGTCAACGTCGGCACCCGCCTGCCGGCCCACGCCACCGTGCTGGGACGCATCCTGCTCGAAGACCTGAGCCTGGCC
GAGCTGCGCGAGCTGTACCCGGAAGAACACCTGGAACAGCACTCGCCGTGCACGCCGAAAACCGTGCTGGAGCTGTTCGA
CCTGGTGCAAAGCGACCGTCAGCGCGGCTATGTCAGCGGCGAAGGTTTCTTCGAGTCGTCGATCTCGACCATCGCCGCCC
CGGTGCGCGATCACAGTGGCCGGGTGGTTGCCGCCATGGGCGTGACCATTCCCACCGTGCAGGTTGGTCACATCAATTTT
GACGGCTTACTCGGCCATGTCCGTGGCAGCGCCGACGAGCTGTCGCGCCTGCTCAACTACACCCCGCACGCAGGCTCCAG
CCGCGTCACCGCGCTGATGAGGGACTGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|