Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
| Location | 809315..809862 | Replicon | chromosome |
| Accession | NZ_CP065369 | ||
| Organism | Vibrio parahaemolyticus strain 20-082A3 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | I5M77_RS04120 | Protein ID | WP_025793438.1 |
| Coordinates | 809560..809862 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | U3A269 |
| Locus tag | I5M77_RS04115 | Protein ID | WP_005448240.1 |
| Coordinates | 809315..809572 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I5M77_RS04060 | 804544..804636 | + | 93 | WP_072612521.1 | DUF3265 domain-containing protein | - |
| I5M77_RS04065 | 805106..805198 | + | 93 | WP_005494820.1 | DUF3265 domain-containing protein | - |
| I5M77_RS04070 | 805226..805606 | + | 381 | WP_104411071.1 | hypothetical protein | - |
| I5M77_RS04075 | 805723..806070 | + | 348 | WP_025793492.1 | DNA-binding protein | - |
| I5M77_RS04080 | 806096..806188 | + | 93 | WP_072606053.1 | DUF3265 domain-containing protein | - |
| I5M77_RS04085 | 806214..806588 | + | 375 | WP_025793490.1 | hypothetical protein | - |
| I5M77_RS04090 | 807222..807311 | + | 90 | WP_074190212.1 | DUF3265 domain-containing protein | - |
| I5M77_RS04095 | 807360..807965 | + | 606 | WP_140142847.1 | hypothetical protein | - |
| I5M77_RS04100 | 807991..808083 | + | 93 | WP_080259420.1 | DUF3265 domain-containing protein | - |
| I5M77_RS04105 | 808526..808654 | + | 129 | WP_080277532.1 | DUF3265 domain-containing protein | - |
| I5M77_RS04110 | 808682..809155 | + | 474 | WP_025534629.1 | hypothetical protein | - |
| I5M77_RS04115 | 809315..809572 | + | 258 | WP_005448240.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| I5M77_RS04120 | 809560..809862 | + | 303 | WP_025793438.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| I5M77_RS04125 | 810029..810574 | + | 546 | WP_025793483.1 | hypothetical protein | - |
| I5M77_RS04130 | 810729..811268 | + | 540 | WP_025793484.1 | hypothetical protein | - |
| I5M77_RS04135 | 811283..811375 | + | 93 | WP_005494856.1 | DUF3265 domain-containing protein | - |
| I5M77_RS04140 | 811420..811704 | + | 285 | WP_017448465.1 | nucleotide pyrophosphohydrolase | - |
| I5M77_RS04145 | 811712..811822 | + | 111 | WP_082798391.1 | DUF3265 domain-containing protein | - |
| I5M77_RS04150 | 811854..812159 | + | 306 | WP_021453216.1 | hypothetical protein | - |
| I5M77_RS04155 | 812303..812650 | + | 348 | WP_005448158.1 | nucleic acid-binding protein | - |
| I5M77_RS04160 | 812676..812768 | + | 93 | WP_078235736.1 | DUF3265 domain-containing protein | - |
| I5M77_RS04165 | 813173..813316 | + | 144 | WP_168937153.1 | DUF3265 domain-containing protein | - |
| I5M77_RS04170 | 813409..813786 | + | 378 | WP_156216529.1 | hypothetical protein | - |
| I5M77_RS04175 | 813928..814653 | + | 726 | WP_025793457.1 | class I SAM-dependent methyltransferase | - |
| I5M77_RS04180 | 814675..814767 | + | 93 | WP_079882702.1 | DUF3265 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | vpadF | 778894..856598 | 77704 | |
| - | inside | Integron | - | - | 780999..825311 | 44312 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11536.51 Da Isoelectric Point: 5.8623
>T182497 WP_025793438.1 NZ_CP065369:809560-809862 [Vibrio parahaemolyticus]
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQAIFSKVERLVAFPESGRIPPELAHLSYREVVVNPCRIFYKQDGDKV
FILFVMRAERDLRKFLLSKQ
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQAIFSKVERLVAFPESGRIPPELAHLSYREVVVNPCRIFYKQDGDKV
FILFVMRAERDLRKFLLSKQ
Download Length: 303 bp
>T182497 NZ_CP086471:68036-68188 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 86 a.a. Molecular weight: 9606.10 Da Isoelectric Point: 6.7269
>AT182497 WP_005448240.1 NZ_CP065369:809315-809572 [Vibrio parahaemolyticus]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLVDVDDYEFMQNRLAILEGIARGERALADGKVVSHDEAKDKM
SKWLK
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLVDVDDYEFMQNRLAILEGIARGERALADGKVVSHDEAKDKM
SKWLK
Download Length: 258 bp
>AT182497 NZ_CP086471:c67986-67924 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|