Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 734639..735197 | Replicon | chromosome |
| Accession | NZ_CP063989 | ||
| Organism | Actinomyces sp. ZJ750 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | ID810_RS03015 | Protein ID | WP_166855219.1 |
| Coordinates | 734639..734959 (-) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | ID810_RS03020 | Protein ID | WP_166855218.1 |
| Coordinates | 734964..735197 (-) | Length | 78 a.a. |
Genomic Context
Location: 729699..729998 (300 bp)
Type: Others
Protein ID: WP_196781517.1
Type: Others
Protein ID: WP_196781517.1
Location: 732563..733315 (753 bp)
Type: Others
Protein ID: WP_166855221.1
Type: Others
Protein ID: WP_166855221.1
Location: 730076..730822 (747 bp)
Type: Others
Protein ID: WP_166855223.1
Type: Others
Protein ID: WP_166855223.1
Location: 730824..731820 (997 bp)
Type: Others
Protein ID: Protein_581
Type: Others
Protein ID: Protein_581
Location: 731817..732101 (285 bp)
Type: Others
Protein ID: WP_166855222.1
Type: Others
Protein ID: WP_166855222.1
Location: 733607..734557 (951 bp)
Type: Others
Protein ID: WP_166855220.1
Type: Others
Protein ID: WP_166855220.1
Location: 734639..734959 (321 bp)
Type: Toxin
Protein ID: WP_166855219.1
Type: Toxin
Protein ID: WP_166855219.1
Location: 734964..735197 (234 bp)
Type: Antitoxin
Protein ID: WP_166855218.1
Type: Antitoxin
Protein ID: WP_166855218.1
Location: 737070..737984 (915 bp)
Type: Others
Protein ID: WP_166855217.1
Type: Others
Protein ID: WP_166855217.1
Location: 737981..738781 (801 bp)
Type: Others
Protein ID: WP_166855216.1
Type: Others
Protein ID: WP_166855216.1
Location: 738778..740133 (1356 bp)
Type: Others
Protein ID: WP_166855215.1
Type: Others
Protein ID: WP_166855215.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ID810_RS02985 | 729699..729998 | + | 300 | WP_196781517.1 | DUF86 domain-containing protein | - |
| ID810_RS02990 | 730076..730822 | - | 747 | WP_166855223.1 | ABC transporter permease | - |
| ID810_RS02995 | 730824..731820 | - | 997 | Protein_581 | ABC transporter ATP-binding protein | - |
| ID810_RS03000 | 731817..732101 | - | 285 | WP_166855222.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| ID810_RS03005 | 732563..733315 | + | 753 | WP_166855221.1 | NAD(P)H-binding protein | - |
| ID810_RS03010 | 733607..734557 | - | 951 | WP_166855220.1 | fructosamine kinase family protein | - |
| ID810_RS03015 | 734639..734959 | - | 321 | WP_166855219.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| ID810_RS03020 | 734964..735197 | - | 234 | WP_166855218.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| ID810_RS03025 | 737070..737984 | - | 915 | WP_166855217.1 | alpha/beta hydrolase | - |
| ID810_RS03030 | 737981..738781 | - | 801 | WP_166855216.1 | alpha/beta hydrolase | - |
| ID810_RS03035 | 738778..740133 | - | 1356 | WP_166855215.1 | sugar porter family MFS transporter | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 729349..737984 | 8635 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 11479.40 Da Isoelectric Point: 7.8692
>T179917 WP_166855219.1 NZ_CP063989:c734959-734639 [Actinomyces sp. ZJ750]
MREIVLAHLDKTRPVLVLTRDRARDAMTKVSVAPITSTVKGLSSELPLGARNGLDHECVASMDNITTLPSRCLGRTIGFL
TVDQEPALARALILAFDLDIPLTGRT
MREIVLAHLDKTRPVLVLTRDRARDAMTKVSVAPITSTVKGLSSELPLGARNGLDHECVASMDNITTLPSRCLGRTIGFL
TVDQEPALARALILAFDLDIPLTGRT
Download Length: 321 bp
>T179917 NZ_CP084899:c1270551-1270444 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 78 a.a. Molecular weight: 8547.48 Da Isoelectric Point: 4.1319
>AT179917 WP_166855218.1 NZ_CP063989:c735197-734964 [Actinomyces sp. ZJ750]
MSTQIAVRLPEDLVAFLDEVVAQGEAPSRAAAVARALERERRERAAAEDARILAELGPQDDLDDLVEWNARATRFED
MSTQIAVRLPEDLVAFLDEVVAQGEAPSRAAAVARALERERRERAAAEDARILAELGPQDDLDDLVEWNARATRFED
Download Length: 234 bp
>AT179917 NZ_CP084899:1270598-1270664 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT