Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 1887020..1887655 | Replicon | chromosome |
Accession | NZ_CP063356 | ||
Organism | Anaerobacillus isosaccharinicus strain NB2006 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A1S2MFS5 |
Locus tag | AWH56_RS09455 | Protein ID | WP_071315458.1 |
Coordinates | 1887305..1887655 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | AWH56_RS09450 | Protein ID | WP_083388403.1 |
Coordinates | 1887020..1887298 (+) | Length | 93 a.a. |
Genomic Context
Location: 1882354..1882710 (357 bp)
Type: Others
Protein ID: WP_071315404.1
Type: Others
Protein ID: WP_071315404.1
Location: 1882886..1884430 (1545 bp)
Type: Others
Protein ID: WP_071315403.1
Type: Others
Protein ID: WP_071315403.1
Location: 1884493..1885518 (1026 bp)
Type: Others
Protein ID: WP_071315402.1
Type: Others
Protein ID: WP_071315402.1
Location: 1885698..1886867 (1170 bp)
Type: Others
Protein ID: WP_071315401.1
Type: Others
Protein ID: WP_071315401.1
Location: 1887020..1887298 (279 bp)
Type: Antitoxin
Protein ID: WP_083388403.1
Type: Antitoxin
Protein ID: WP_083388403.1
Location: 1887305..1887655 (351 bp)
Type: Toxin
Protein ID: WP_071315458.1
Type: Toxin
Protein ID: WP_071315458.1
Location: 1887996..1888814 (819 bp)
Type: Others
Protein ID: WP_071315399.1
Type: Others
Protein ID: WP_071315399.1
Location: 1888837..1889193 (357 bp)
Type: Others
Protein ID: WP_071315398.1
Type: Others
Protein ID: WP_071315398.1
Location: 1889196..1889594 (399 bp)
Type: Others
Protein ID: WP_071315397.1
Type: Others
Protein ID: WP_071315397.1
Location: 1889609..1890622 (1014 bp)
Type: Others
Protein ID: WP_071315396.1
Type: Others
Protein ID: WP_071315396.1
Location: 1890673..1891005 (333 bp)
Type: Others
Protein ID: WP_071315395.1
Type: Others
Protein ID: WP_071315395.1
Location: 1891002..1891490 (489 bp)
Type: Others
Protein ID: WP_083388402.1
Type: Others
Protein ID: WP_083388402.1
Location: 1891450..1892235 (786 bp)
Type: Others
Protein ID: WP_071315394.1
Type: Others
Protein ID: WP_071315394.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AWH56_RS09430 | 1882354..1882710 | + | 357 | WP_071315404.1 | holo-ACP synthase | - |
AWH56_RS09435 | 1882886..1884430 | + | 1545 | WP_071315403.1 | bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase | - |
AWH56_RS09440 | 1884493..1885518 | + | 1026 | WP_071315402.1 | outer membrane lipoprotein-sorting protein | - |
AWH56_RS09445 | 1885698..1886867 | + | 1170 | WP_071315401.1 | alanine racemase | - |
AWH56_RS09450 | 1887020..1887298 | + | 279 | WP_083388403.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
AWH56_RS09455 | 1887305..1887655 | + | 351 | WP_071315458.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
AWH56_RS09460 | 1887996..1888814 | + | 819 | WP_071315399.1 | STAS domain-containing protein | - |
AWH56_RS09465 | 1888837..1889193 | + | 357 | WP_071315398.1 | STAS domain-containing protein | - |
AWH56_RS09470 | 1889196..1889594 | + | 399 | WP_071315397.1 | anti-sigma regulatory factor | - |
AWH56_RS09475 | 1889609..1890622 | + | 1014 | WP_071315396.1 | PP2C family protein-serine/threonine phosphatase | - |
AWH56_RS09480 | 1890673..1891005 | + | 333 | WP_071315395.1 | STAS domain-containing protein | - |
AWH56_RS09485 | 1891002..1891490 | + | 489 | WP_083388402.1 | anti-sigma B factor RsbW | - |
AWH56_RS09490 | 1891450..1892235 | + | 786 | WP_071315394.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12929.92 Da Isoelectric Point: 6.4673
>T178008 WP_071315458.1 NZ_CP063356:1887305-1887655 [Anaerobacillus isosaccharinicus]
IVVKRGDVYFADLSPVVGSEQGGVRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKRYGFDRDSVILLEQV
RTIDKQRLTDKITHLDDDMMSRVNEALQISLGLIDF
IVVKRGDVYFADLSPVVGSEQGGVRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKRYGFDRDSVILLEQV
RTIDKQRLTDKITHLDDDMMSRVNEALQISLGLIDF
Download Length: 351 bp
>T178008 NZ_CP083809:1696883-1696969 [Pantoea agglomerans]
GCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCAAAGAGCCATTTCCCTGGACCGAATACAGGAATCGTGTTCGGTC
TTTTTTT
GCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCAAAGAGCCATTTCCCTGGACCGAATACAGGAATCGTGTTCGGTC
TTTTTTT
Antitoxin
Download Length: 93 a.a. Molecular weight: 10573.06 Da Isoelectric Point: 7.2044
>AT178008 WP_083388403.1 NZ_CP063356:1887020-1887298 [Anaerobacillus isosaccharinicus]
VSANTKRITVSLPQHLLNEVDGLIKRENVNRSEFISQATKEYLREKKKRQIRETMQQGYMEMAKINLNIAAEAFLAEEEA
EHTRTLDLVSGV
VSANTKRITVSLPQHLLNEVDGLIKRENVNRSEFISQATKEYLREKKKRQIRETMQQGYMEMAKINLNIAAEAFLAEEEA
EHTRTLDLVSGV
Download Length: 279 bp
>AT178008 NZ_CP083809:c1696969-1696883 [Pantoea agglomerans]
AAAAAAAGACCGAACACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTTGAGAGCCGTGCGCTAAAAGTTGGCATTAA
TGCAGGC
AAAAAAAGACCGAACACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTTGAGAGCCGTGCGCTAAAAGTTGGCATTAA
TGCAGGC
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1S2MFS5 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |