Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 177642..178198 | Replicon | chromosome |
Accession | NZ_CP061539 | ||
Organism | Rothia terrae strain KJZ-14 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | IDM49_RS00845 | Protein ID | WP_190724690.1 |
Coordinates | 177881..178198 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | IDM49_RS00840 | Protein ID | WP_168614382.1 |
Coordinates | 177642..177872 (+) | Length | 77 a.a. |
Genomic Context
Location: 177214..177522 (309 bp)
Type: Others
Protein ID: WP_168614381.1
Type: Others
Protein ID: WP_168614381.1
Location: 177642..177872 (231 bp)
Type: Antitoxin
Protein ID: WP_168614382.1
Type: Antitoxin
Protein ID: WP_168614382.1
Location: 177881..178198 (318 bp)
Type: Toxin
Protein ID: WP_190724690.1
Type: Toxin
Protein ID: WP_190724690.1
Location: 178940..179836 (897 bp)
Type: Others
Protein ID: WP_190724692.1
Type: Others
Protein ID: WP_190724692.1
Location: 181629..182396 (768 bp)
Type: Others
Protein ID: WP_190724694.1
Type: Others
Protein ID: WP_190724694.1
Location: 173163..175277 (2115 bp)
Type: Others
Protein ID: WP_168614378.1
Type: Others
Protein ID: WP_168614378.1
Location: 175597..176592 (996 bp)
Type: Others
Protein ID: WP_190725503.1
Type: Others
Protein ID: WP_190725503.1
Location: 176535..176975 (441 bp)
Type: Others
Protein ID: WP_190724689.1
Type: Others
Protein ID: WP_190724689.1
Location: 178249..178893 (645 bp)
Type: Others
Protein ID: WP_190724691.1
Type: Others
Protein ID: WP_190724691.1
Location: 179935..180839 (905 bp)
Type: Others
Protein ID: Protein_166
Type: Others
Protein ID: Protein_166
Location: 181053..181472 (420 bp)
Type: Others
Protein ID: WP_190724693.1
Type: Others
Protein ID: WP_190724693.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IDM49_RS00820 | 173163..175277 | - | 2115 | WP_168614378.1 | phosphate acetyltransferase | - |
IDM49_RS00825 | 175597..176592 | - | 996 | WP_190725503.1 | MFS transporter | - |
IDM49_RS00830 | 176535..176975 | - | 441 | WP_190724689.1 | MFS transporter | - |
IDM49_RS00835 | 177214..177522 | + | 309 | WP_168614381.1 | thiamine-binding protein | - |
IDM49_RS00840 | 177642..177872 | + | 231 | WP_168614382.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
IDM49_RS00845 | 177881..178198 | + | 318 | WP_190724690.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
IDM49_RS00850 | 178249..178893 | - | 645 | WP_190724691.1 | GNAT family N-acetyltransferase | - |
IDM49_RS00855 | 178940..179836 | + | 897 | WP_190724692.1 | fused MFS/spermidine synthase | - |
IDM49_RS00860 | 179935..180839 | - | 905 | Protein_166 | Ltp family lipoprotein | - |
IDM49_RS00865 | 181053..181472 | - | 420 | WP_190724693.1 | YchJ family protein | - |
IDM49_RS00870 | 181629..182396 | + | 768 | WP_190724694.1 | fructosamine kinase family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11402.30 Da Isoelectric Point: 7.1344
>T172735 WP_190724690.1 NZ_CP061539:177881-178198 [Rothia terrae]
MREICLVHLDKTRPALVLTREPTRFVMSKITIAPITSTVKGLSSEVLLGSQNGLNHECVASIDNILTVPASALGRTIGYL
TETQEKDLTRAVVLAFDLRVPLSEG
MREICLVHLDKTRPALVLTREPTRFVMSKITIAPITSTVKGLSSEVLLGSQNGLNHECVASIDNILTVPASALGRTIGYL
TETQEKDLTRAVVLAFDLRVPLSEG
Download Length: 318 bp
>T172735 NZ_CP079891:c2910873-2910721 [Escherichia fergusonii]
ATGCCGCAGAAATATAGATTACTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGAGAATTATGAGCTGGCGGCGTTTTTAGCCTGCAAATTGAAAGAGTAA
ATGCCGCAGAAATATAGATTACTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGAGAATTATGAGCTGGCGGCGTTTTTAGCCTGCAAATTGAAAGAGTAA
Antitoxin
Download Length: 77 a.a. Molecular weight: 8269.11 Da Isoelectric Point: 3.9129
>AT172735 WP_168614382.1 NZ_CP061539:177642-177872 [Rothia terrae]
MTTQIAVRLPDDLVEFLDSAVAHGEAPSRAAIVAEALEQERRKYAARADTQILQEQGTEDDLDDLVAWTASSAVID
MTTQIAVRLPDDLVEFLDSAVAHGEAPSRAAIVAEALEQERRKYAARADTQILQEQGTEDDLDDLVAWTASSAVID
Download Length: 231 bp
>AT172735 NZ_CP079891:2910930-2910978 [Escherichia fergusonii]
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG