Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2158463..2158989 | Replicon | chromosome |
Accession | NZ_CP061530 | ||
Organism | Escherichia coli strain WEM25 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | H5V41_RS10480 | Protein ID | WP_000323025.1 |
Coordinates | 2158463..2158750 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | H5V41_RS10485 | Protein ID | WP_000534858.1 |
Coordinates | 2158750..2158989 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H5V41_RS10445 | 2154145..2155104 | - | 960 | WP_000592549.1 | DUF523 and DUF1722 domain-containing protein | - |
H5V41_RS10450 | 2155297..2155821 | + | 525 | WP_000780584.1 | lipocalin family protein | - |
H5V41_RS10455 | 2155977..2156354 | - | 378 | WP_001204787.1 | antitermination protein | - |
H5V41_RS10460 | 2156372..2157421 | - | 1050 | WP_190812214.1 | DUF968 domain-containing protein | - |
H5V41_RS10465 | 2157423..2157701 | - | 279 | WP_001515373.1 | hypothetical protein | - |
H5V41_RS10470 | 2157768..2158019 | - | 252 | WP_001463433.1 | hypothetical protein | - |
H5V41_RS10475 | 2158236..2158391 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
H5V41_RS10480 | 2158463..2158750 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
H5V41_RS10485 | 2158750..2158989 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
H5V41_RS10490 | 2159014..2159319 | + | 306 | WP_071593935.1 | hypothetical protein | - |
H5V41_RS10495 | 2159522..2159854 | + | 333 | WP_001301033.1 | protein FlxA | - |
H5V41_RS10500 | 2160291..2161631 | - | 1341 | WP_000589013.1 | ISNCY family transposase | - |
H5V41_RS10505 | 2162170..2163332 | + | 1163 | WP_126323058.1 | IS3-like element IS3 family transposase | - |
H5V41_RS10510 | 2163526..2163774 | + | 249 | Protein_2047 | transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2146263..2183282 | 37019 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T172717 WP_000323025.1 NZ_CP061530:c2158750-2158463 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
>T172717 NZ_CP079884:c4451553-4451446 [Escherichia fergusonii]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 80 a.a. Molecular weight: 9071.48 Da Isoelectric Point: 4.5230
>AT172717 WP_000534858.1 NZ_CP061530:c2158989-2158750 [Escherichia coli]
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
Download Length: 240 bp
>AT172717 NZ_CP079884:4451601-4451667 [Escherichia fergusonii]
GGTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GGTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|