Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 5034084..5034610 | Replicon | chromosome |
Accession | NZ_CP059962 | ||
Organism | Pectobacterium brasiliense strain IPO:3710 NAK:380 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | H5A25_RS22185 | Protein ID | WP_119871147.1 |
Coordinates | 5034084..5034389 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | C6C380 |
Locus tag | H5A25_RS22190 | Protein ID | WP_015855076.1 |
Coordinates | 5034392..5034610 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H5A25_RS22155 | 5029085..5029339 | - | 255 | WP_119871224.1 | helix-turn-helix domain-containing protein | - |
H5A25_RS22160 | 5029443..5029685 | + | 243 | WP_072010299.1 | helix-turn-helix domain-containing protein | - |
H5A25_RS22165 | 5030025..5030318 | + | 294 | WP_038921611.1 | DUF1778 domain-containing protein | - |
H5A25_RS22170 | 5030315..5030809 | + | 495 | WP_119871144.1 | GNAT family N-acetyltransferase | - |
H5A25_RS22175 | 5031235..5032956 | + | 1722 | WP_119871145.1 | AAA family ATPase | - |
H5A25_RS22180 | 5033042..5033884 | + | 843 | WP_119871146.1 | DNA adenine methylase | - |
H5A25_RS22185 | 5034084..5034389 | - | 306 | WP_119871147.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
H5A25_RS22190 | 5034392..5034610 | - | 219 | WP_015855076.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
H5A25_RS22195 | 5034669..5035412 | - | 744 | WP_119871148.1 | molybdopterin-guanine dinucleotide biosynthesis protein MobC | - |
H5A25_RS22200 | 5035505..5035855 | + | 351 | WP_158586005.1 | hypothetical protein | - |
H5A25_RS22205 | 5036309..5036650 | - | 342 | WP_119871225.1 | hypothetical protein | - |
H5A25_RS22210 | 5036836..5037030 | + | 195 | WP_044209559.1 | DUF3950 domain-containing protein | - |
H5A25_RS22215 | 5037146..5038408 | - | 1263 | WP_119871150.1 | integrase arm-type DNA-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 5029769..5038585 | 8816 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11759.63 Da Isoelectric Point: 4.6533
>T169620 WP_119871147.1 NZ_CP059962:c5034389-5034084 [Pectobacterium brasiliense]
MQFIVYQYKRASHYKMFVDVQSDIVETPKRRMVIPLIEAYHLSEKVNKTLFPLIRIDGEDYRLMTTELSSVPVEVIGEVT
ADLGDYADEIKDAINLMFWGI
MQFIVYQYKRASHYKMFVDVQSDIVETPKRRMVIPLIEAYHLSEKVNKTLFPLIRIDGEDYRLMTTELSSVPVEVIGEVT
ADLGDYADEIKDAINLMFWGI
Download Length: 306 bp
>T169620 NZ_CP076645:2827864-2827971 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 73 a.a. Molecular weight: 8178.13 Da Isoelectric Point: 7.0135
>AT169620 WP_015855076.1 NZ_CP059962:c5034610-5034392 [Pectobacterium brasiliense]
MKHRVSVTVDKDNYQVLSAAGVNISGLVNDAIGKEARRIKAEEWKKENREGMEEVARFIAQNGSFADENRNW
MKHRVSVTVDKDNYQVLSAAGVNISGLVNDAIGKEARRIKAEEWKKENREGMEEVARFIAQNGSFADENRNW
Download Length: 219 bp
>AT169620 NZ_CP076645:c2827817-2827751 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|