Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 93428..93954 | Replicon | plasmid p48212_MCR |
Accession | NZ_CP059413 | ||
Organism | Enterobacter hormaechei strain ENCL48212 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | H1D56_RS00545 | Protein ID | WP_000323025.1 |
Coordinates | 93667..93954 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | H1D56_RS00540 | Protein ID | WP_000534858.1 |
Coordinates | 93428..93667 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1D56_RS00525 | 89756..90994 | + | 1239 | WP_000219087.1 | IS110 family transposase | - |
H1D56_RS00530 | 91470..92042 | + | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
H1D56_RS00535 | 92242..93165 | + | 924 | WP_000167917.1 | cation diffusion facilitator family transporter | - |
H1D56_RS00540 | 93428..93667 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
H1D56_RS00545 | 93667..93954 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
H1D56_RS00550 | 94026..94184 | + | 159 | WP_001447866.1 | type I toxin-antitoxin system Hok family toxin | - |
H1D56_RS00555 | 94793..95113 | - | 321 | WP_000332796.1 | hypothetical protein | - |
H1D56_RS00560 | 95645..95995 | - | 351 | WP_000743059.1 | hypothetical protein | - |
H1D56_RS00565 | 96055..96657 | - | 603 | WP_012695474.1 | hypothetical protein | - |
H1D56_RS00570 | 96753..97697 | - | 945 | WP_000778029.1 | DUF5417 domain-containing protein | - |
H1D56_RS00575 | 98208..98384 | + | 177 | WP_001371930.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaSHV-12 / sul2 / sul1 / qacE / ere(A) / aac(6')-IIc / tet(D) / mcr-9 / aph(6)-Id / aph(3'')-Ib / dfrA19 / qnrA1 / aadA2 / catA2 / blaTEM-1B | - | 1..302551 | 302551 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T168786 WP_000323025.1 NZ_CP059413:93667-93954 [Enterobacter hormaechei]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
>T168786 NZ_CP076241:293163-293270 [Escherichia coli O157:H7]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 80 a.a. Molecular weight: 9071.48 Da Isoelectric Point: 4.5230
>AT168786 WP_000534858.1 NZ_CP059413:93428-93667 [Enterobacter hormaechei]
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
Download Length: 240 bp
>AT168786 NZ_CP076241:c293115-293049 [Escherichia coli O157:H7]
GGTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GGTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|