Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mbcAT/RES-Xre |
Location | 7547..8445 | Replicon | plasmid pHP17a |
Accession | NZ_CP059000 | ||
Organism | Mycobacterium avium subsp. hominissuis strain HP17 |
Toxin (Protein)
Gene name | mbcT | Uniprot ID | A0A859PX34 |
Locus tag | BEP52_RS23750 | Protein ID | WP_023870434.1 |
Coordinates | 7885..8445 (+) | Length | 187 a.a. |
Antitoxin (Protein)
Gene name | mbcA | Uniprot ID | A0A859PYE6 |
Locus tag | BEP52_RS23745 | Protein ID | WP_023870435.1 |
Coordinates | 7547..7888 (+) | Length | 114 a.a. |
Genomic Context
Location: 2581..3423 (843 bp)
Type: Others
Protein ID: WP_023870443.1
Type: Others
Protein ID: WP_023870443.1
Location: 3639..3890 (252 bp)
Type: Others
Protein ID: WP_023870442.1
Type: Others
Protein ID: WP_023870442.1
Location: 3887..4303 (417 bp)
Type: Others
Protein ID: WP_023870441.1
Type: Others
Protein ID: WP_023870441.1
Location: 5024..5185 (162 bp)
Type: Others
Protein ID: WP_023870439.1
Type: Others
Protein ID: WP_023870439.1
Location: 7547..7888 (342 bp)
Type: Antitoxin
Protein ID: WP_023870435.1
Type: Antitoxin
Protein ID: WP_023870435.1
Location: 7885..8445 (561 bp)
Type: Toxin
Protein ID: WP_023870434.1
Type: Toxin
Protein ID: WP_023870434.1
Location: 4408..4848 (441 bp)
Type: Others
Protein ID: WP_023870440.1
Type: Others
Protein ID: WP_023870440.1
Location: 6307..7458 (1152 bp)
Type: Others
Protein ID: WP_023870436.1
Type: Others
Protein ID: WP_023870436.1
Location: 8661..9011 (351 bp)
Type: Others
Protein ID: WP_023870433.1
Type: Others
Protein ID: WP_023870433.1
Location: 9008..10711 (1704 bp)
Type: Others
Protein ID: WP_158423352.1
Type: Others
Protein ID: WP_158423352.1
Location: 10728..11033 (306 bp)
Type: Others
Protein ID: WP_023870373.1
Type: Others
Protein ID: WP_023870373.1
Location: 11109..11414 (306 bp)
Type: Others
Protein ID: WP_134798478.1
Type: Others
Protein ID: WP_134798478.1
Location: 11444..12988 (1545 bp)
Type: Others
Protein ID: WP_134798479.1
Type: Others
Protein ID: WP_134798479.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BEP52_RS23715 | 2581..3423 | + | 843 | WP_023870443.1 | ParB/RepB/Spo0J family partition protein | - |
BEP52_RS23720 | 3639..3890 | + | 252 | WP_023870442.1 | ribbon-helix-helix protein, CopG family | - |
BEP52_RS23725 | 3887..4303 | + | 417 | WP_023870441.1 | type II toxin-antitoxin system VapC family toxin | - |
BEP52_RS23730 | 4408..4848 | - | 441 | WP_023870440.1 | hypothetical protein | - |
BEP52_RS23735 | 5024..5185 | + | 162 | WP_023870439.1 | hypothetical protein | - |
BEP52_RS23740 | 6307..7458 | - | 1152 | WP_023870436.1 | hypothetical protein | - |
BEP52_RS23745 | 7547..7888 | + | 342 | WP_023870435.1 | DUF2384 domain-containing protein | Antitoxin |
BEP52_RS23750 | 7885..8445 | + | 561 | WP_023870434.1 | RES domain-containing protein | Toxin |
BEP52_RS23755 | 8661..9011 | - | 351 | WP_023870433.1 | hypothetical protein | - |
BEP52_RS23760 | 9008..10711 | - | 1704 | WP_158423352.1 | WXG100 family type VII secretion target | - |
BEP52_RS23765 | 10728..11033 | - | 306 | WP_023870373.1 | hypothetical protein | - |
BEP52_RS23770 | 11109..11414 | - | 306 | WP_134798478.1 | hypothetical protein | - |
BEP52_RS23775 | 11444..12988 | - | 1545 | WP_134798479.1 | DUF4226 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | esxN / eccA5 / esxN | 1..150076 | 150076 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 187 a.a. Molecular weight: 20272.58 Da Isoelectric Point: 4.8677
>T168071 WP_023870434.1 NZ_CP059000:7885-8445 [Mycobacterium avium subsp. hominissuis]
VSDALDEDLLQRIDARGTTPWSATCFRYTGAHRDPLSGEGARRFGGRWNPPLLFSAIYLSDSAQACMVEVGRAAQAASTT
AEKLLEASYRLHTVEATDLAVLDLTTPEARDTVGLEDDDIHGEDWSACQAVGHAAWFLHMQGILVPAAGGVGLVITAYEQ
RTRPGQLQVSHSEDLTPARYQELRHK
VSDALDEDLLQRIDARGTTPWSATCFRYTGAHRDPLSGEGARRFGGRWNPPLLFSAIYLSDSAQACMVEVGRAAQAASTT
AEKLLEASYRLHTVEATDLAVLDLTTPEARDTVGLEDDDIHGEDWSACQAVGHAAWFLHMQGILVPAAGGVGLVITAYEQ
RTRPGQLQVSHSEDLTPARYQELRHK
Download Length: 561 bp
>T168071 NZ_CP075627:c1942953-1942846 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 114 a.a. Molecular weight: 12350.16 Da Isoelectric Point: 5.0916
>AT168071 WP_023870435.1 NZ_CP059000:7547-7888 [Mycobacterium avium subsp. hominissuis]
MGVNALASTVSSAIERLGLTYEEVGGIVDASARSVARWTSGQVVPQRLNKQRLIELAYVADALAEVLPRDQANVWMFSPN
RLLQHAKPADLVRDGEYQRVLALIDAMAEGIFV
MGVNALASTVSSAIERLGLTYEEVGGIVDASARSVARWTSGQVVPQRLNKQRLIELAYVADALAEVLPRDQANVWMFSPN
RLLQHAKPADLVRDGEYQRVLALIDAMAEGIFV
Download Length: 342 bp
>AT168071 NZ_CP075627:1943000-1943066 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A859PX34 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A859PYE6 |