Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/HTH_31(antitoxin) |
Location | 521753..522370 | Replicon | chromosome |
Accession | NZ_CP058669 | ||
Organism | Hyphobacterium sp. CCMP332 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | HXX25_RS02665 | Protein ID | WP_187167731.1 |
Coordinates | 521753..522004 (+) | Length | 84 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | HXX25_RS02670 | Protein ID | WP_187166983.1 |
Coordinates | 522014..522370 (+) | Length | 119 a.a. |
Genomic Context
Location: 520745..521659 (915 bp)
Type: Others
Protein ID: WP_187166982.1
Type: Others
Protein ID: WP_187166982.1
Location: 521753..522004 (252 bp)
Type: Toxin
Protein ID: WP_187167731.1
Type: Toxin
Protein ID: WP_187167731.1
Location: 522014..522370 (357 bp)
Type: Antitoxin
Protein ID: WP_187166983.1
Type: Antitoxin
Protein ID: WP_187166983.1
Location: 523461..523721 (261 bp)
Type: Others
Protein ID: WP_187166985.1
Type: Others
Protein ID: WP_187166985.1
Location: 526274..527008 (735 bp)
Type: Others
Protein ID: WP_187166988.1
Type: Others
Protein ID: WP_187166988.1
Location: 516796..517971 (1176 bp)
Type: Others
Protein ID: WP_187166978.1
Type: Others
Protein ID: WP_187166978.1
Location: 518011..519405 (1395 bp)
Type: Others
Protein ID: WP_187166979.1
Type: Others
Protein ID: WP_187166979.1
Location: 519517..520146 (630 bp)
Type: Others
Protein ID: WP_187166980.1
Type: Others
Protein ID: WP_187166980.1
Location: 520391..520621 (231 bp)
Type: Others
Protein ID: WP_187166981.1
Type: Others
Protein ID: WP_187166981.1
Location: 522367..523260 (894 bp)
Type: Others
Protein ID: WP_187166984.1
Type: Others
Protein ID: WP_187166984.1
Location: 523861..524217 (357 bp)
Type: Others
Protein ID: WP_187166986.1
Type: Others
Protein ID: WP_187166986.1
Location: 524369..526168 (1800 bp)
Type: Others
Protein ID: WP_187166987.1
Type: Others
Protein ID: WP_187166987.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HXX25_RS02640 | 516796..517971 | - | 1176 | WP_187166978.1 | VWA domain-containing protein | - |
HXX25_RS02645 | 518011..519405 | - | 1395 | WP_187166979.1 | hypothetical protein | - |
HXX25_RS02650 | 519517..520146 | - | 630 | WP_187166980.1 | CatB-related O-acetyltransferase | - |
HXX25_RS02655 | 520391..520621 | - | 231 | WP_187166981.1 | YdcH family protein | - |
HXX25_RS02660 | 520745..521659 | + | 915 | WP_187166982.1 | hydrogen peroxide-inducible genes activator | - |
HXX25_RS02665 | 521753..522004 | + | 252 | WP_187167731.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
HXX25_RS02670 | 522014..522370 | + | 357 | WP_187166983.1 | helix-turn-helix transcriptional regulator | Antitoxin |
HXX25_RS02675 | 522367..523260 | - | 894 | WP_187166984.1 | MoxR family ATPase | - |
HXX25_RS02680 | 523461..523721 | + | 261 | WP_187166985.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
HXX25_RS02685 | 523861..524217 | - | 357 | WP_187166986.1 | hypothetical protein | - |
HXX25_RS02690 | 524369..526168 | - | 1800 | WP_187166987.1 | tetratricopeptide repeat protein | - |
HXX25_RS02695 | 526274..527008 | + | 735 | WP_187166988.1 | SDR family NAD(P)-dependent oxidoreductase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 9377.92 Da Isoelectric Point: 10.5420
>T167105 WP_187167731.1 NZ_CP058669:521753-522004 [Hyphobacterium sp. CCMP332]
MRSVSYTKSALKVLRKMSRPDALRIMAEVDQFAIDPESLANNVKRLQGSDFIRLRVGDWRVIMDDQGAVLAVIRIGPRGS
VYE
MRSVSYTKSALKVLRKMSRPDALRIMAEVDQFAIDPESLANNVKRLQGSDFIRLRVGDWRVIMDDQGAVLAVIRIGPRGS
VYE
Download Length: 252 bp
>T167105 NZ_CP074680:2672826-2672933 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 119 a.a. Molecular weight: 13006.93 Da Isoelectric Point: 6.4735
>AT167105 WP_187166983.1 NZ_CP058669:522014-522370 [Hyphobacterium sp. CCMP332]
MQTINTPDGGIMVMLALEEYQALVDAADIAEGHRIRQRLASGEEELLPSDMVRRLVAGETPLRVWRKYRGISAADLARQA
HLSRAYISQIETGKRQPGVAALRRIATVLNADLDDLVA
MQTINTPDGGIMVMLALEEYQALVDAADIAEGHRIRQRLASGEEELLPSDMVRRLVAGETPLRVWRKYRGISAADLARQA
HLSRAYISQIETGKRQPGVAALRRIATVLNADLDDLVA
Download Length: 357 bp
>AT167105 NZ_CP074680:c2672779-2672713 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT