Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2664349..2664875 | Replicon | chromosome |
Accession | NZ_CP057620 | ||
Organism | Citrobacter sp. RHB21-C01 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | HVX68_RS12855 | Protein ID | WP_000323025.1 |
Coordinates | 2664588..2664875 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | HVX68_RS12850 | Protein ID | WP_000534858.1 |
Coordinates | 2664349..2664588 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HVX68_RS12815 | 2659968..2660249 | - | 282 | WP_181821503.1 | phage holin family protein | - |
HVX68_RS12820 | 2660236..2660631 | - | 396 | WP_042291608.1 | phage holin family protein | - |
HVX68_RS12835 | 2661707..2663047 | + | 1341 | WP_181821504.1 | ISNCY family transposase | - |
HVX68_RS12840 | 2663484..2663816 | - | 333 | WP_001317460.1 | FlxA-like family protein | - |
HVX68_RS12845 | 2664019..2664324 | - | 306 | WP_001326990.1 | hypothetical protein | - |
HVX68_RS12850 | 2664349..2664588 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
HVX68_RS12855 | 2664588..2664875 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
HVX68_RS12860 | 2664974..2665783 | - | 810 | WP_181821505.1 | antitermination protein | - |
HVX68_RS12865 | 2665783..2665920 | - | 138 | WP_181821506.1 | YlcG family protein | - |
HVX68_RS12870 | 2665917..2666273 | - | 357 | WP_181821507.1 | RusA family crossover junction endodeoxyribonuclease | - |
HVX68_RS12875 | 2666270..2666551 | - | 282 | WP_181821508.1 | hypothetical protein | - |
HVX68_RS12880 | 2666751..2667356 | - | 606 | WP_181821509.1 | DUF1367 family protein | - |
HVX68_RS12885 | 2667441..2667662 | - | 222 | WP_181821510.1 | hypothetical protein | - |
HVX68_RS12890 | 2667772..2668005 | - | 234 | WP_181821511.1 | DinI-like family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2607228..2727943 | 120715 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T165563 WP_000323025.1 NZ_CP057620:2664588-2664875 [Citrobacter sp. RHB21-C01]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
>T165563 NZ_CP073926:2750952-2751059 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 80 a.a. Molecular weight: 9071.48 Da Isoelectric Point: 4.5230
>AT165563 WP_000534858.1 NZ_CP057620:2664349-2664588 [Citrobacter sp. RHB21-C01]
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
Download Length: 240 bp
>AT165563 NZ_CP073926:c2750905-2750839 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|