Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 207055..207605 | Replicon | plasmid pRHB35-C21_2 |
| Accession | NZ_CP057148 | ||
| Organism | Citrobacter sp. RHB35-C21 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1EZ93 |
| Locus tag | HVZ39_RS26100 | Protein ID | WP_007372286.1 |
| Coordinates | 207297..207605 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1FMC3 |
| Locus tag | HVZ39_RS26095 | Protein ID | WP_007372285.1 |
| Coordinates | 207055..207294 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HVZ39_RS26050 | 202062..202457 | + | 396 | WP_024196081.1 | hypothetical protein | - |
| HVZ39_RS26055 | 202639..202830 | + | 192 | WP_016241560.1 | hypothetical protein | - |
| HVZ39_RS26060 | 202961..203656 | + | 696 | WP_007372278.1 | hypothetical protein | - |
| HVZ39_RS26065 | 203679..203876 | + | 198 | WP_032155220.1 | Lar family restriction alleviation protein | - |
| HVZ39_RS26070 | 203929..204387 | + | 459 | WP_008786599.1 | hypothetical protein | - |
| HVZ39_RS26075 | 204535..204675 | + | 141 | WP_007372281.1 | hypothetical protein | - |
| HVZ39_RS26080 | 204691..205323 | + | 633 | WP_007372282.1 | hypothetical protein | - |
| HVZ39_RS26085 | 205784..206455 | + | 672 | WP_007372283.1 | hypothetical protein | - |
| HVZ39_RS26090 | 206452..206916 | + | 465 | WP_008786596.1 | hypothetical protein | - |
| HVZ39_RS26095 | 207055..207294 | + | 240 | WP_007372285.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| HVZ39_RS26100 | 207297..207605 | + | 309 | WP_007372286.1 | CcdB family protein | Toxin |
| HVZ39_RS26105 | 207626..207784 | + | 159 | WP_016241558.1 | hypothetical protein | - |
| HVZ39_RS26110 | 207939..208493 | + | 555 | WP_007372288.1 | hypothetical protein | - |
| HVZ39_RS26115 | 208563..209180 | + | 618 | WP_007372289.1 | hypothetical protein | - |
| HVZ39_RS26120 | 209263..209733 | + | 471 | WP_007372290.1 | hypothetical protein | - |
| HVZ39_RS26125 | 210080..210322 | + | 243 | WP_007372291.1 | hypothetical protein | - |
| HVZ39_RS26130 | 210333..210731 | + | 399 | WP_007372292.1 | hypothetical protein | - |
| HVZ39_RS26135 | 210815..211141 | + | 327 | WP_007372293.1 | hypothetical protein | - |
| HVZ39_RS26140 | 211504..211842 | - | 339 | WP_007372294.1 | hypothetical protein | - |
| HVZ39_RS26145 | 212080..212523 | + | 444 | WP_007372295.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | - | 1..252642 | 252642 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11351.17 Da Isoelectric Point: 8.5044
>T164874 WP_007372286.1 NZ_CP057148:207297-207605 [Citrobacter sp. RHB35-C21]
MQYTVYRNPGNSQAYPYLLDIQSDIIGELNTRLVIPLHRLKKGASAPVARLTPVIQVEGNDVILMTHEMASVRVKQLGQA
VMDASPFRHTIKSAVDFLLDGF
MQYTVYRNPGNSQAYPYLLDIQSDIIGELNTRLVIPLHRLKKGASAPVARLTPVIQVEGNDVILMTHEMASVRVKQLGQA
VMDASPFRHTIKSAVDFLLDGF
Download Length: 309 bp
>T164874 NZ_CP073362:c64505-64356 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGAGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGAGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 80 a.a. Molecular weight: 8784.97 Da Isoelectric Point: 8.6387
>AT164874 WP_007372285.1 NZ_CP057148:207055-207294 [Citrobacter sp. RHB35-C21]
MQATAARQKKTVSVTLEPMLVQQAKDAGINLSATLAEALQSKLKASAAEEWKRQNRAGIQELNRITEEHGLLSDEYRTF
MQATAARQKKTVSVTLEPMLVQQAKDAGINLSATLAEALQSKLKASAAEEWKRQNRAGIQELNRITEEHGLLSDEYRTF
Download Length: 240 bp
>AT164874 NZ_CP073362:64549-64610 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|