Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc(toxin) |
Location | 316348..316919 | Replicon | chromosome |
Accession | NZ_CP053823 | ||
Organism | Vibrio cholerae strain E7G |
Toxin (Protein)
Gene name | doc | Uniprot ID | Q9KMA2 |
Locus tag | HPY10_RS14860 | Protein ID | WP_000351248.1 |
Coordinates | 316518..316919 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | Q8GNG3 |
Locus tag | HPY10_RS14855 | Protein ID | WP_001080654.1 |
Coordinates | 316348..316518 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HPY10_RS14805 | 312582..312735 | + | 154 | Protein_252 | DUF645 family protein | - |
HPY10_RS14810 | 312976..313146 | + | 171 | WP_001080654.1 | hypothetical protein | - |
HPY10_RS14815 | 313146..313547 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
HPY10_RS14820 | 313450..313713 | + | 264 | WP_175247629.1 | DUF3265 domain-containing protein | - |
HPY10_RS14825 | 313688..314053 | + | 366 | WP_069730855.1 | hypothetical protein | - |
HPY10_RS14830 | 314209..314484 | + | 276 | WP_000436062.1 | hypothetical protein | - |
HPY10_RS14835 | 314630..314968 | + | 339 | WP_175246331.1 | hypothetical protein | - |
HPY10_RS14840 | 315125..315403 | - | 279 | WP_000578473.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
HPY10_RS14845 | 315400..315684 | - | 285 | WP_000381186.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
HPY10_RS14850 | 315893..316168 | + | 276 | WP_000436062.1 | hypothetical protein | - |
HPY10_RS14855 | 316348..316518 | + | 171 | WP_001080654.1 | hypothetical protein | Antitoxin |
HPY10_RS14860 | 316518..316919 | + | 402 | WP_000351248.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
HPY10_RS14865 | 316906..317055 | + | 150 | WP_175247721.1 | DUF3265 domain-containing protein | - |
HPY10_RS14870 | 317042..317323 | + | 282 | WP_084981660.1 | DUF1289 domain-containing protein | - |
HPY10_RS14875 | 317571..318371 | + | 801 | WP_114763308.1 | nucleotide-binding protein | - |
HPY10_RS14880 | 318362..318478 | + | 117 | WP_114763309.1 | DUF3265 domain-containing protein | - |
HPY10_RS14885 | 318569..318850 | + | 282 | WP_000086649.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
HPY10_RS14890 | 318847..319134 | + | 288 | WP_000869999.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
HPY10_RS14895 | 319265..319564 | - | 300 | WP_000802134.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
HPY10_RS14900 | 319561..319803 | - | 243 | WP_001107720.1 | type II toxin-antitoxin system ParD family antitoxin | - |
HPY10_RS14905 | 320515..320955 | + | 441 | WP_095473997.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 310054..527444 | 217390 | |
- | inside | Integron | - | - | 311218..527444 | 216226 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14608.71 Da Isoelectric Point: 4.0128
>T158074 WP_000351248.1 NZ_CP053823:316518-316919 [Vibrio cholerae]
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL
Download Length: 402 bp
>T158074 NZ_CP069561:c90700-90551 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATACCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 57 a.a. Molecular weight: 6287.35 Da Isoelectric Point: 10.7274
>AT158074 WP_001080654.1 NZ_CP053823:316348-316518 [Vibrio cholerae]
MNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM
MNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM
Download Length: 171 bp
>AT158074 NZ_CP069561:90748-90804 [Escherichia coli]
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Q0PN34 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1T4SJJ1 |