Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc(toxin)
Location 316348..316919 Replicon chromosome
Accession NZ_CP053823
Organism Vibrio cholerae strain E7G

Toxin (Protein)


Gene name doc Uniprot ID Q9KMA2
Locus tag HPY10_RS14860 Protein ID WP_000351248.1
Coordinates 316518..316919 (+) Length 134 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID Q8GNG3
Locus tag HPY10_RS14855 Protein ID WP_001080654.1
Coordinates 316348..316518 (+) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HPY10_RS14805 312582..312735 + 154 Protein_252 DUF645 family protein -
HPY10_RS14810 312976..313146 + 171 WP_001080654.1 hypothetical protein -
HPY10_RS14815 313146..313547 + 402 WP_000351248.1 type II toxin-antitoxin system death-on-curing family toxin -
HPY10_RS14820 313450..313713 + 264 WP_175247629.1 DUF3265 domain-containing protein -
HPY10_RS14825 313688..314053 + 366 WP_069730855.1 hypothetical protein -
HPY10_RS14830 314209..314484 + 276 WP_000436062.1 hypothetical protein -
HPY10_RS14835 314630..314968 + 339 WP_175246331.1 hypothetical protein -
HPY10_RS14840 315125..315403 - 279 WP_000578473.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family -
HPY10_RS14845 315400..315684 - 285 WP_000381186.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
HPY10_RS14850 315893..316168 + 276 WP_000436062.1 hypothetical protein -
HPY10_RS14855 316348..316518 + 171 WP_001080654.1 hypothetical protein Antitoxin
HPY10_RS14860 316518..316919 + 402 WP_000351248.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
HPY10_RS14865 316906..317055 + 150 WP_175247721.1 DUF3265 domain-containing protein -
HPY10_RS14870 317042..317323 + 282 WP_084981660.1 DUF1289 domain-containing protein -
HPY10_RS14875 317571..318371 + 801 WP_114763308.1 nucleotide-binding protein -
HPY10_RS14880 318362..318478 + 117 WP_114763309.1 DUF3265 domain-containing protein -
HPY10_RS14885 318569..318850 + 282 WP_000086649.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
HPY10_RS14890 318847..319134 + 288 WP_000869999.1 type II toxin-antitoxin system RelE/ParE family toxin -
HPY10_RS14895 319265..319564 - 300 WP_000802134.1 type II toxin-antitoxin system RelE/ParE family toxin -
HPY10_RS14900 319561..319803 - 243 WP_001107720.1 type II toxin-antitoxin system ParD family antitoxin -
HPY10_RS14905 320515..320955 + 441 WP_095473997.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 310054..527444 217390
- inside Integron - - 311218..527444 216226


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-132)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14608.71 Da        Isoelectric Point: 4.0128

>T158074 WP_000351248.1 NZ_CP053823:316518-316919 [Vibrio cholerae]
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL

Download         Length: 402 bp

>T158074 NZ_CP069561:c90700-90551 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6287.35 Da        Isoelectric Point: 10.7274

>AT158074 WP_001080654.1 NZ_CP053823:316348-316518 [Vibrio cholerae]
MNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM

Download         Length: 171 bp

>AT158074 NZ_CP069561:90748-90804 [Escherichia coli]
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Q0PN34

Antitoxin

Source ID Structure
AlphaFold DB A0A1T4SJJ1

References