Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 418951..419516 Replicon chromosome
Accession NZ_CP053817
Organism Vibrio cholerae strain SA7G

Toxin (Protein)


Gene name relE Uniprot ID D7HCW8
Locus tag HPY17_RS15740 Protein ID WP_000869999.1
Coordinates 419229..419516 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID D0IIK3
Locus tag HPY17_RS15735 Protein ID WP_000086649.1
Coordinates 418951..419232 (+) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HPY17_RS15685 414106..414393 + 288 WP_000869999.1 type II toxin-antitoxin system RelE/ParE family toxin -
HPY17_RS15690 414620..414886 + 267 WP_175246421.1 hypothetical protein -
HPY17_RS15695 415061..415456 + 396 WP_175246422.1 DUF3465 domain-containing protein -
HPY17_RS15700 415583..415744 + 162 WP_175246423.1 hypothetical protein -
HPY17_RS15705 415933..416043 + 111 WP_175246602.1 DUF3265 domain-containing protein -
HPY17_RS15710 416087..416446 + 360 WP_076025909.1 VOC family protein -
HPY17_RS15715 416615..417091 + 477 WP_175246603.1 DUF2059 domain-containing protein -
HPY17_RS15720 417291..418085 - 795 WP_175246424.1 NYN domain-containing protein -
HPY17_RS15725 418172..418327 + 156 WP_175246425.1 DUF3265 domain-containing protein -
HPY17_RS15730 418579..418692 + 114 Protein_437 DUF645 family protein -
HPY17_RS15735 418951..419232 + 282 WP_000086649.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
HPY17_RS15740 419229..419516 + 288 WP_000869999.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
HPY17_RS15745 419696..420199 + 504 WP_001158952.1 DinB family protein -
HPY17_RS15750 420566..420675 + 110 Protein_441 DUF645 family protein -
HPY17_RS15755 420877..421254 + 378 WP_055028395.1 hypothetical protein -
HPY17_RS15760 421256..421546 + 291 WP_055028394.1 hypothetical protein -
HPY17_RS15765 421550..421718 + 169 Protein_444 DUF3265 domain-containing protein -
HPY17_RS15770 421702..422583 + 882 WP_175247672.1 restriction endonuclease -
HPY17_RS15775 422553..422697 + 145 Protein_446 DUF3265 domain-containing protein -
HPY17_RS15780 422732..423208 + 477 WP_175246430.1 DM13 domain-containing protein -
HPY17_RS15785 423343..423660 + 318 WP_175246431.1 hypothetical protein -
HPY17_RS15790 423902..424327 + 426 WP_114808311.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 310054..510566 200512
- inside Integron - - 311218..510566 199348


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(9-74)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10997.74 Da        Isoelectric Point: 6.0710

>T158038 WP_000869999.1 NZ_CP053817:419229-419516 [Vibrio cholerae]
MKVVWSPLALQKLGDAAEFIALDNPSAAEKWVNEVFDKTELLGSMPEMGRMVPEMPHTNYREIIFGHYRIIYSLSHEIRV
LTVRNCRQLLTEHDV

Download         Length: 288 bp

>T158038 NZ_CP069549:2594391-2594543 [Escherichia coli]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10361.93 Da        Isoelectric Point: 5.1548

>AT158038 WP_000086649.1 NZ_CP053817:418951-419232 [Vibrio cholerae]
MSRIHLDQDIQPLSEFRAGVASFIKQINETRRPLVITQRGKGVAVVLDVAEYEAMQEKIELLEEMRTAEAQLAAGLGISN
EDARSQVLGRIIK

Download         Length: 282 bp

>AT158038 NZ_CP069549:c2594342-2594285 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3AEF1

Antitoxin

Source ID Structure
AlphaFold DB A0A0K9UIW4

References