Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 403458..403986 | Replicon | chromosome |
Accession | NZ_CP053814 | ||
Organism | Vibrio cholerae strain W7G |
Toxin (Protein)
Gene name | relE | Uniprot ID | H9L4R3 |
Locus tag | HPY09_RS15495 | Protein ID | WP_000221352.1 |
Coordinates | 403458..403748 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | HPY09_RS15500 | Protein ID | WP_000213182.1 |
Coordinates | 403738..403986 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HPY09_RS15455 | 398494..398907 | + | 414 | WP_000049417.1 | VOC family protein | - |
HPY09_RS15460 | 399563..400771 | + | 1209 | WP_158160342.1 | deoxyguanosinetriphosphate triphosphohydrolase family protein | - |
HPY09_RS15465 | 400781..400891 | + | 111 | WP_082798410.1 | DUF3265 domain-containing protein | - |
HPY09_RS15470 | 400954..401238 | + | 285 | WP_000048765.1 | antibiotic biosynthesis monooxygenase | - |
HPY09_RS15475 | 401668..401790 | + | 123 | WP_082321036.1 | DUF3265 domain-containing protein | - |
HPY09_RS15480 | 401967..402053 | + | 87 | WP_175247335.1 | DUF645 family protein | - |
HPY09_RS15485 | 402053..402145 | + | 93 | Protein_400 | DUF645 family protein | - |
HPY09_RS15490 | 402852..403277 | + | 426 | WP_000415750.1 | hypothetical protein | - |
HPY09_RS15495 | 403458..403748 | - | 291 | WP_000221352.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
HPY09_RS15500 | 403738..403986 | - | 249 | WP_000213182.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
HPY09_RS15505 | 404178..404666 | + | 489 | WP_175247181.1 | GNAT family N-acetyltransferase | - |
HPY09_RS15510 | 404809..405444 | + | 636 | WP_069648801.1 | hypothetical protein | - |
HPY09_RS15515 | 405771..405950 | + | 180 | WP_050547145.1 | DUF645 family protein | - |
HPY09_RS15520 | 406784..406965 | + | 182 | Protein_407 | DUF645 family protein | - |
HPY09_RS15525 | 407161..407478 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
HPY09_RS15530 | 407497..407739 | - | 243 | WP_001961623.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
HPY09_RS15535 | 408062..408310 | + | 249 | WP_175247182.1 | DUF645 family protein | - |
HPY09_RS15540 | 408600..408707 | + | 108 | Protein_411 | ggdef family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integron | - | - | 317876..527757 | 209881 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11247.23 Da Isoelectric Point: 10.4678
>T158016 WP_000221352.1 NZ_CP053814:c403748-403458 [Vibrio cholerae]
MTYKLEFKKSALKEWKKLAVPLQQQFKKKLIERLENPHVPSAKLSGAENIYKIKLRQSGYRLVYQVENDIIVVTVLAVGK
RERSEVYTKALQRLDD
MTYKLEFKKSALKEWKKLAVPLQQQFKKKLIERLENPHVPSAKLSGAENIYKIKLRQSGYRLVYQVENDIIVVTVLAVGK
RERSEVYTKALQRLDD
Download Length: 291 bp
>T158016 NZ_CP069542:3175275-3175382 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 83 a.a. Molecular weight: 8964.31 Da Isoelectric Point: 4.1079
>AT158016 WP_000213182.1 NZ_CP053814:c403986-403738 [Vibrio cholerae]
MTTRILADVAASITEFKANPMKVATSAFGAPVAVLNRNEPAFYCVPANTYELMMDKLEDLELLAIAKERLSEDSVSVNID
DL
MTTRILADVAASITEFKANPMKVATSAFGAPVAVLNRNEPAFYCVPANTYELMMDKLEDLELLAIAKERLSEDSVSVNID
DL
Download Length: 249 bp
>AT158016 NZ_CP069542:c3175228-3175162 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|