Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 496928..497466 | Replicon | chromosome |
Accession | NZ_CP053809 | ||
Organism | Vibrio cholerae strain SP7G |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A0N8UHD2 |
Locus tag | HPY08_RS15625 | Protein ID | WP_000802131.1 |
Coordinates | 496928..497227 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A0Q0JMN6 |
Locus tag | HPY08_RS15630 | Protein ID | WP_002044787.1 |
Coordinates | 497224..497466 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HPY08_RS15585 | 492354..492590 | + | 237 | WP_162805884.1 | DUF645 family protein | - |
HPY08_RS15590 | 492795..493646 | + | 852 | WP_000446947.1 | hypothetical protein | - |
HPY08_RS15595 | 493734..494396 | + | 663 | WP_000084910.1 | Vat family streptogramin A O-acetyltransferase | - |
HPY08_RS15600 | 494748..494843 | + | 96 | WP_001907607.1 | DUF645 family protein | - |
HPY08_RS15605 | 495041..495526 | + | 486 | WP_175242902.1 | GNAT family N-acetyltransferase | - |
HPY08_RS15610 | 495511..495633 | + | 123 | WP_175242903.1 | DUF3265 domain-containing protein | - |
HPY08_RS15615 | 495820..495969 | + | 150 | Protein_537 | DUF645 family protein | - |
HPY08_RS15620 | 496169..496804 | + | 636 | WP_095474051.1 | hypothetical protein | - |
HPY08_RS15625 | 496928..497227 | - | 300 | WP_000802131.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
HPY08_RS15630 | 497224..497466 | - | 243 | WP_002044787.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
HPY08_RS15635 | 497514..497645 | + | 132 | WP_080483479.1 | DUF3265 domain-containing protein | - |
HPY08_RS15640 | 497832..498011 | + | 180 | WP_095457894.1 | DUF645 family protein | - |
HPY08_RS15645 | 498235..498975 | + | 741 | WP_175243021.1 | PhzF family phenazine biosynthesis protein | - |
HPY08_RS15650 | 499119..499607 | + | 489 | WP_069648819.1 | hypothetical protein | - |
HPY08_RS15655 | 499630..500589 | - | 960 | WP_001107099.1 | IS30 family transposase | - |
HPY08_RS15660 | 500831..501439 | + | 609 | WP_000529841.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
HPY08_RS15665 | 501447..501557 | + | 111 | WP_080008060.1 | DUF3265 domain-containing protein | - |
HPY08_RS15670 | 501648..501929 | + | 282 | WP_000086649.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
HPY08_RS15675 | 501926..502213 | + | 288 | WP_000869999.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 338606..521339 | 182733 | |
- | inside | Integron | - | - | 339770..520450 | 180680 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11607.26 Da Isoelectric Point: 9.9232
>T157988 WP_000802131.1 NZ_CP053809:c497227-496928 [Vibrio cholerae]
MKPFNLTTAAKTDLRDIALFTQRRWGKEQRNIYLKQFDDSFWLLAENPDIGKSCDEIRDGYRKFPQGSHVIFYQQTGSQQ
IRVVRILHKSMDVNPIFGA
MKPFNLTTAAKTDLRDIALFTQRRWGKEQRNIYLKQFDDSFWLLAENPDIGKSCDEIRDGYRKFPQGSHVIFYQQTGSQQ
IRVVRILHKSMDVNPIFGA
Download Length: 300 bp
>T157988 NZ_CP069528:4524544-4524651 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 81 a.a. Molecular weight: 8979.81 Da Isoelectric Point: 4.1677
>AT157988 WP_002044787.1 NZ_CP053809:c497466-497224 [Vibrio cholerae]
MAKNTSITLGEHFDGFITNQIQSGRYGSASEVIRSALRLLENQETKLQTLRQLLVEGEQSGDADYDLDSFINELDSETNR
MAKNTSITLGEHFDGFITNQIQSGRYGSASEVIRSALRLLENQETKLQTLRQLLVEGEQSGDADYDLDSFINELDSETNR
Download Length: 243 bp
>AT157988 NZ_CP069528:c4524495-4524429 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTGATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0N8UHD2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Q0JMN6 |