Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc(toxin)
Location 550461..551032 Replicon chromosome
Accession NZ_CP053805
Organism Vibrio cholerae strain SL6Y

Toxin (Protein)


Gene name doc Uniprot ID Q9KMA2
Locus tag HPY06_RS15945 Protein ID WP_000351248.1
Coordinates 550461..550862 (-) Length 134 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID Q8GNG3
Locus tag HPY06_RS15950 Protein ID WP_001080654.1
Coordinates 550862..551032 (-) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HPY06_RS15915 547054..547668 - 615 WP_000675194.1 OmpA family protein -
HPY06_RS15920 547890..548363 + 474 WP_000034756.1 FKBP-type peptidyl-prolyl cis-trans isomerase -
HPY06_RS15925 548444..548878 - 435 WP_175231880.1 IS200/IS605 family transposase -
HPY06_RS15930 548865..548992 - 128 Protein_551 DUF645 family protein -
HPY06_RS15935 549333..549809 - 477 WP_001047188.1 GNAT family N-acetyltransferase -
HPY06_RS15940 550006..550188 - 183 WP_175231582.1 DUF645 family protein -
HPY06_RS15945 550461..550862 - 402 WP_000351248.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
HPY06_RS15950 550862..551032 - 171 WP_001080654.1 hypothetical protein Antitoxin
HPY06_RS15955 551272..551310 - 39 WP_108244118.1 hypothetical protein -
HPY06_RS15960 551326..551454 - 129 WP_001886422.1 DUF645 family protein -
HPY06_RS15965 551775..552011 - 237 WP_046126177.1 hypothetical protein -
HPY06_RS15970 552014..552397 - 384 Protein_559 PhzF family phenazine biosynthesis protein -
HPY06_RS15975 552894..553217 - 324 WP_080476600.1 DUF3709 domain-containing protein -
HPY06_RS15980 553413..553700 - 288 WP_000869999.1 type II toxin-antitoxin system RelE/ParE family toxin -
HPY06_RS15985 553697..553978 - 282 WP_000086649.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
HPY06_RS15990 554177..554917 - 741 WP_042991272.1 PhzF family phenazine biosynthesis protein -
HPY06_RS15995 555083..555538 - 456 WP_001245329.1 GNAT family N-acetyltransferase -
HPY06_RS16000 555658..555975 - 318 WP_001232701.1 HigA family addiction module antidote protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integron - - 549333..598232 48899
- flank IS/Tn - - 548444..548992 548
- inside Genomic island - - 549333..599478 50145


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-132)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14608.71 Da        Isoelectric Point: 4.0128

>T157944 WP_000351248.1 NZ_CP053805:c550862-550461 [Vibrio cholerae]
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL

Download         Length: 402 bp

>T157944 NZ_CP069522:121453-121560 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6287.35 Da        Isoelectric Point: 10.7274

>AT157944 WP_001080654.1 NZ_CP053805:c551032-550862 [Vibrio cholerae]
MNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM

Download         Length: 171 bp

>AT157944 NZ_CP069522:c121396-121341 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Q0PN34

Antitoxin

Source ID Structure
AlphaFold DB A0A1T4SJJ1

References