Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 316963..317501 | Replicon | chromosome |
Accession | NZ_CP053805 | ||
Organism | Vibrio cholerae strain SL6Y |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | HPY06_RS14490 | Protein ID | WP_000802134.1 |
Coordinates | 316963..317262 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | P58093 |
Locus tag | HPY06_RS14495 | Protein ID | WP_001107719.1 |
Coordinates | 317259..317501 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HPY06_RS14460 | 313115..313705 | + | 591 | WP_175231326.1 | hypothetical protein | - |
HPY06_RS14465 | 313847..314281 | + | 435 | WP_059261346.1 | hypothetical protein | - |
HPY06_RS14470 | 314400..314711 | - | 312 | WP_095474019.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
HPY06_RS14475 | 314708..314950 | - | 243 | WP_001107719.1 | type II toxin-antitoxin system ParD family antitoxin | - |
HPY06_RS14480 | 315166..315921 | + | 756 | WP_175231329.1 | hypothetical protein | - |
HPY06_RS14485 | 316133..316846 | + | 714 | WP_000123659.1 | Fic family protein | - |
HPY06_RS14490 | 316963..317262 | - | 300 | WP_000802134.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
HPY06_RS14495 | 317259..317501 | - | 243 | WP_001107719.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
HPY06_RS14500 | 317740..318810 | + | 1071 | WP_094132855.1 | hypothetical protein | - |
HPY06_RS14505 | 318804..318917 | + | 114 | Protein_267 | DUF3265 domain-containing protein | - |
HPY06_RS14510 | 319104..319319 | + | 216 | WP_154139263.1 | DUF645 family protein | - |
HPY06_RS14515 | 319496..319909 | + | 414 | WP_095475342.1 | GNAT family N-acetyltransferase | - |
HPY06_RS14520 | 320169..320405 | + | 237 | WP_175231332.1 | DUF645 family protein | - |
HPY06_RS14525 | 320758..320911 | + | 154 | Protein_271 | DUF645 family protein | - |
HPY06_RS14530 | 321114..321578 | + | 465 | WP_002033245.1 | GNAT family N-acetyltransferase | - |
HPY06_RS14535 | 321717..322316 | + | 600 | WP_095464298.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 308588..403342 | 94754 | |
- | inside | Integron | - | - | 309752..402202 | 92450 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11601.34 Da Isoelectric Point: 9.9232
>T157939 WP_000802134.1 NZ_CP053805:c317262-316963 [Vibrio cholerae]
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQIGSQQ
IRVIRILHKSMDVNPIFGA
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQIGSQQ
IRVIRILHKSMDVNPIFGA
Download Length: 300 bp
>T157939 NZ_CP069517:c4781384-4781232 [Escherichia coli]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
Antitoxin
Download Length: 81 a.a. Molecular weight: 8964.84 Da Isoelectric Point: 4.1677
>AT157939 WP_001107719.1 NZ_CP053805:c317501-317259 [Vibrio cholerae]
MAKNTSITLGEHFDGFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLRQLLIEGEQSGDADYDLDSFINELDSENIR
MAKNTSITLGEHFDGFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLRQLLIEGEQSGDADYDLDSFINELDSENIR
Download Length: 243 bp
>AT157939 NZ_CP069517:4781433-4781490 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|