Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-Phd |
Location | 314130..314708 | Replicon | chromosome |
Accession | NZ_CP053801 | ||
Organism | Vibrio cholerae strain SO5Y |
Toxin (Protein)
Gene name | parE | Uniprot ID | O68848 |
Locus tag | HPY15_RS14750 | Protein ID | WP_001180243.1 |
Coordinates | 314130..314447 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | HPY15_RS14755 | Protein ID | WP_001961623.1 |
Coordinates | 314466..314708 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HPY15_RS14720 | 309256..309381 | + | 126 | WP_175236093.1 | DUF3265 domain-containing protein | - |
HPY15_RS14725 | 309410..311233 | + | 1824 | WP_175235966.1 | hypothetical protein | - |
HPY15_RS14730 | 311372..311869 | + | 498 | WP_055030562.1 | DUF2867 domain-containing protein | - |
HPY15_RS14735 | 312400..312933 | + | 534 | WP_000679873.1 | GNAT family N-acetyltransferase | - |
HPY15_RS14740 | 313074..313460 | + | 387 | WP_089069923.1 | MmcQ/YjbR family DNA-binding protein | - |
HPY15_RS14745 | 313755..313937 | + | 183 | WP_000947519.1 | DUF645 family protein | - |
HPY15_RS14750 | 314130..314447 | - | 318 | WP_001180243.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
HPY15_RS14755 | 314466..314708 | - | 243 | WP_001961623.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
HPY15_RS14760 | 314955..315731 | + | 777 | WP_175235968.1 | hypothetical protein | - |
HPY15_RS14765 | 315897..316310 | + | 414 | WP_142738042.1 | GNAT family N-acetyltransferase | - |
HPY15_RS14770 | 316448..316765 | - | 318 | WP_000077272.1 | CcdB family protein | - |
HPY15_RS14775 | 316765..317010 | - | 246 | WP_001260801.1 | type II toxin-antitoxin system CcdA family antitoxin | - |
HPY15_RS14780 | 317208..317570 | + | 363 | WP_175235970.1 | hypothetical protein | - |
HPY15_RS14785 | 317713..318471 | + | 759 | WP_175235971.1 | restriction endonuclease | - |
HPY15_RS14790 | 318824..318919 | + | 96 | WP_001907607.1 | DUF645 family protein | - |
HPY15_RS14795 | 319129..319584 | + | 456 | WP_000432865.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 296008..431802 | 135794 | |
- | inside | Integron | - | - | 297172..370435 | 73263 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12158.97 Da Isoelectric Point: 9.7495
>T157900 WP_001180243.1 NZ_CP053801:c314447-314130 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
MQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAN
FILIVAVLGQSQLPQKHLKQSRFVS
Download Length: 318 bp
>T157900 NZ_CP069501:c4552004-4551897 [Escherichia coli]
ATGACGCTCGCAGCGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGCGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 81 a.a. Molecular weight: 8931.22 Da Isoelectric Point: 5.6630
>AT157900 WP_001961623.1 NZ_CP053801:c314708-314466 [Vibrio cholerae]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDGGKTVDGATFLNTL
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDGGKTVDGATFLNTL
Download Length: 243 bp
>AT157900 NZ_CP069501:4552052-4552118 [Escherichia coli]
GGTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GGTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|