Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-RHH |
| Location | 2143465..2143997 | Replicon | chromosome |
| Accession | NZ_CP053084 | ||
| Organism | Limnobacter sp. SAORIC-580 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | HKT17_RS10010 | Protein ID | WP_171099770.1 |
| Coordinates | 2143701..2143997 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | HKT17_RS10005 | Protein ID | WP_171099768.1 |
| Coordinates | 2143465..2143704 (+) | Length | 80 a.a. |
Genomic Context
Location: 2140034..2142223 (2190 bp)
Type: Others
Protein ID: WP_171099761.1
Type: Others
Protein ID: WP_171099761.1
Location: 2142370..2142840 (471 bp)
Type: Others
Protein ID: WP_171099763.1
Type: Others
Protein ID: WP_171099763.1
Location: 2142851..2143390 (540 bp)
Type: Others
Protein ID: WP_171099765.1
Type: Others
Protein ID: WP_171099765.1
Location: 2143465..2143704 (240 bp)
Type: Antitoxin
Protein ID: WP_171099768.1
Type: Antitoxin
Protein ID: WP_171099768.1
Location: 2143701..2143997 (297 bp)
Type: Toxin
Protein ID: WP_171099770.1
Type: Toxin
Protein ID: WP_171099770.1
Location: 2144094..2144363 (270 bp)
Type: Others
Protein ID: WP_171099773.1
Type: Others
Protein ID: WP_171099773.1
Location: 2144360..2144869 (510 bp)
Type: Others
Protein ID: WP_171099775.1
Type: Others
Protein ID: WP_171099775.1
Location: 2144878..2145213 (336 bp)
Type: Others
Protein ID: WP_171099776.1
Type: Others
Protein ID: WP_171099776.1
Location: 2145298..2145924 (627 bp)
Type: Others
Protein ID: WP_205882412.1
Type: Others
Protein ID: WP_205882412.1
Location: 2146154..2146444 (291 bp)
Type: Others
Protein ID: WP_205882413.1
Type: Others
Protein ID: WP_205882413.1
Location: 2146812..2147054 (243 bp)
Type: Others
Protein ID: WP_171099780.1
Type: Others
Protein ID: WP_171099780.1
Location: 2147098..2147694 (597 bp)
Type: Others
Protein ID: WP_171099781.1
Type: Others
Protein ID: WP_171099781.1
Location: 2147765..2148181 (417 bp)
Type: Others
Protein ID: WP_171099783.1
Type: Others
Protein ID: WP_171099783.1
Location: 2148283..2148849 (567 bp)
Type: Others
Protein ID: WP_171099786.1
Type: Others
Protein ID: WP_171099786.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HKT17_RS09990 | 2140034..2142223 | + | 2190 | WP_171099761.1 | malate synthase G | - |
| HKT17_RS09995 | 2142370..2142840 | + | 471 | WP_171099763.1 | C40 family peptidase | - |
| HKT17_RS10000 | 2142851..2143390 | + | 540 | WP_171099765.1 | hypothetical protein | - |
| HKT17_RS10005 | 2143465..2143704 | + | 240 | WP_171099768.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| HKT17_RS10010 | 2143701..2143997 | + | 297 | WP_171099770.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| HKT17_RS10015 | 2144094..2144363 | - | 270 | WP_171099773.1 | hypothetical protein | - |
| HKT17_RS10020 | 2144360..2144869 | - | 510 | WP_171099775.1 | hypothetical protein | - |
| HKT17_RS10025 | 2144878..2145213 | - | 336 | WP_171099776.1 | hypothetical protein | - |
| HKT17_RS10030 | 2145298..2145924 | - | 627 | WP_205882412.1 | hypothetical protein | - |
| HKT17_RS10035 | 2146154..2146444 | - | 291 | WP_205882413.1 | putative addiction module antidote protein | - |
| HKT17_RS10040 | 2146812..2147054 | - | 243 | WP_171099780.1 | VF530 family protein | - |
| HKT17_RS10045 | 2147098..2147694 | - | 597 | WP_171099781.1 | hypothetical protein | - |
| HKT17_RS10050 | 2147765..2148181 | - | 417 | WP_171099783.1 | VOC family protein | - |
| HKT17_RS10055 | 2148283..2148849 | - | 567 | WP_171099786.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11323.15 Da Isoelectric Point: 11.1458
>T156007 WP_171099770.1 NZ_CP053084:2143701-2143997 [Limnobacter sp. SAORIC-580]
MTKPFLLTVAARNDLLNIARFTAKRWGNPQRNKYLKQLDDTFRLLARQPEIGIDASGIKPGYRKFVLGSHVIFYRDGSNS
KVVVVRVFHHRMDVDSHL
MTKPFLLTVAARNDLLNIARFTAKRWGNPQRNKYLKQLDDTFRLLARQPEIGIDASGIKPGYRKFVLGSHVIFYRDGSNS
KVVVVRVFHHRMDVDSHL
Download Length: 297 bp
>T156007 NZ_CP068823:c2192733-2192635 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGGCTGGTGGCGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGGCTGGTGGCGTAA
Antitoxin
Download Length: 80 a.a. Molecular weight: 8833.67 Da Isoelectric Point: 4.1813
>AT156007 WP_171099768.1 NZ_CP053084:2143465-2143704 [Limnobacter sp. SAORIC-580]
MAKNTSVSLGPHFDQFIASQVQNGRYGSASEVVRAGLRLLEENETQLTQLRRLLEEGEQSGLSDYSYDDLISQLDKEAE
MAKNTSVSLGPHFDQFIASQVQNGRYGSASEVVRAGLRLLEENETQLTQLRRLLEEGEQSGLSDYSYDDLISQLDKEAE
Download Length: 240 bp
>AT156007 NZ_CP068823:2192780-2192846 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT