Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/COG3657-dnstrm_HI1420 |
Location | 50762..51291 | Replicon | plasmid Plas1 |
Accession | NZ_CP052093 | ||
Organism | Ralstonia solanacearum strain FJAT15340.F50 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | HI811_RS17280 | Protein ID | WP_011003396.1 |
Coordinates | 51064..51291 (-) | Length | 76 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0S4U6E5 |
Locus tag | HI811_RS17275 | Protein ID | WP_064478231.1 |
Coordinates | 50762..51067 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HI811_RS17245 | 46264..46749 | + | 486 | WP_016726511.1 | hypothetical protein | - |
HI811_RS17250 | 47080..47361 | - | 282 | WP_016722336.1 | hypothetical protein | - |
HI811_RS17255 | 47492..47776 | - | 285 | WP_011003391.1 | hypothetical protein | - |
HI811_RS17260 | 48109..48296 | + | 188 | Protein_46 | IS5/IS1182 family transposase | - |
HI811_RS17265 | 48463..49131 | + | 669 | WP_038938024.1 | hypothetical protein | - |
HI811_RS17270 | 49236..50549 | - | 1314 | WP_064478230.1 | metabolite/H+ symporter | - |
HI811_RS17275 | 50762..51067 | - | 306 | WP_064478231.1 | putative addiction module antidote protein | Antitoxin |
HI811_RS17280 | 51064..51291 | - | 228 | WP_011003396.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
HI811_RS17285 | 51447..52646 | - | 1200 | WP_071623818.1 | MFS transporter | - |
HI811_RS17290 | 52773..53594 | - | 822 | WP_011003398.1 | GntR family transcriptional regulator | - |
HI811_RS17295 | 53772..54323 | - | 552 | WP_011003399.1 | helix-turn-helix transcriptional regulator | - |
HI811_RS17300 | 54456..55055 | + | 600 | WP_064478235.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | cyaB / flgC / flgG / fliM / fliG / fliI / acrB / adeG / cheY / cheB / cheW / motA | 1..2053891 | 2053891 | |
- | flank | IS/Tn | - | - | 45140..46105 | 965 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 76 a.a. Molecular weight: 8544.80 Da Isoelectric Point: 6.4584
>T155468 WP_011003396.1 NZ_CP052093:c51291-51064 [Ralstonia solanacearum]
VRIDRLQMGNPGDMKAVRDGIRELRIDHGPGDRLYFVRHGVVLIVLLCGGDKSTQETDIRRAIDLSRRLDVDDME
VRIDRLQMGNPGDMKAVRDGIRELRIDHGPGDRLYFVRHGVVLIVLLCGGDKSTQETDIRRAIDLSRRLDVDDME
Download Length: 228 bp
>T155468 NZ_CP068803:2718905-2719012 [Escherichia coli]
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 102 a.a. Molecular weight: 10983.62 Da Isoelectric Point: 7.2780
>AT155468 WP_064478231.1 NZ_CP052093:c51067-50762 [Ralstonia solanacearum]
MTMAQRTIKTRLWDSAEHLRTEADIAAYLDACLEEAGDDPAFITHALGVVARSRGMTQLARETGMTREGLYKALSEGGNP
SFATVLKVIRALGIRLHAVPT
MTMAQRTIKTRLWDSAEHLRTEADIAAYLDACLEEAGDDPAFITHALGVVARSRGMTQLARETGMTREGLYKALSEGGNP
SFATVLKVIRALGIRLHAVPT
Download Length: 306 bp
>AT155468 NZ_CP068803:c2718852-2718791 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|