Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yoeB-relB/Txe-YefM |
| Location | 1968301..1968803 | Replicon | chromosome |
| Accession | NZ_CP051684 | ||
| Organism | Duganella sp. AF9R3 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | - |
| Locus tag | HH213_RS09160 | Protein ID | WP_169112059.1 |
| Coordinates | 1968540..1968803 (+) | Length | 88 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | HH213_RS09155 | Protein ID | WP_169112058.1 |
| Coordinates | 1968301..1968543 (+) | Length | 81 a.a. |
Genomic Context
Location: 1968301..1968543 (243 bp)
Type: Antitoxin
Protein ID: WP_169112058.1
Type: Antitoxin
Protein ID: WP_169112058.1
Location: 1968540..1968803 (264 bp)
Type: Toxin
Protein ID: WP_169112059.1
Type: Toxin
Protein ID: WP_169112059.1
Location: 1972530..1973786 (1257 bp)
Type: Others
Protein ID: WP_110845578.1
Type: Others
Protein ID: WP_110845578.1
Location: 1964000..1965211 (1212 bp)
Type: Others
Protein ID: WP_110845569.1
Type: Others
Protein ID: WP_110845569.1
Location: 1965283..1966278 (996 bp)
Type: Others
Protein ID: WP_169112055.1
Type: Others
Protein ID: WP_169112055.1
Location: 1966327..1967124 (798 bp)
Type: Others
Protein ID: WP_169112056.1
Type: Others
Protein ID: WP_169112056.1
Location: 1967128..1968180 (1053 bp)
Type: Others
Protein ID: WP_169112057.1
Type: Others
Protein ID: WP_169112057.1
Location: 1968800..1969135 (336 bp)
Type: Others
Protein ID: WP_169112060.1
Type: Others
Protein ID: WP_169112060.1
Location: 1970147..1971595 (1449 bp)
Type: Others
Protein ID: WP_169112061.1
Type: Others
Protein ID: WP_169112061.1
Location: 1971595..1972320 (726 bp)
Type: Others
Protein ID: WP_169112062.1
Type: Others
Protein ID: WP_169112062.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HH213_RS09135 | 1964000..1965211 | - | 1212 | WP_110845569.1 | MFS transporter | - |
| HH213_RS09140 | 1965283..1966278 | - | 996 | WP_169112055.1 | Gfo/Idh/MocA family oxidoreductase | - |
| HH213_RS09145 | 1966327..1967124 | - | 798 | WP_169112056.1 | DUF3025 domain-containing protein | - |
| HH213_RS09150 | 1967128..1968180 | - | 1053 | WP_169112057.1 | dihydroorotase | - |
| HH213_RS09155 | 1968301..1968543 | + | 243 | WP_169112058.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| HH213_RS09160 | 1968540..1968803 | + | 264 | WP_169112059.1 | Txe/YoeB family addiction module toxin | Toxin |
| HH213_RS09165 | 1968800..1969135 | - | 336 | WP_169112060.1 | DUF2314 domain-containing protein | - |
| HH213_RS09170 | 1970147..1971595 | - | 1449 | WP_169112061.1 | amidohydrolase family protein | - |
| HH213_RS09175 | 1971595..1972320 | - | 726 | WP_169112062.1 | amino acid ABC transporter ATP-binding protein | - |
| HH213_RS09180 | 1972530..1973786 | + | 1257 | WP_110845578.1 | dicarboxylate/amino acid:cation symporter | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1962953..1974026 | 11073 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10184.84 Da Isoelectric Point: 10.2660
>T154745 WP_169112059.1 NZ_CP051684:1968540-1968803 [Duganella sp. AF9R3]
VSWQLVYSRQAEKDAKKLAVAHLKKQTQALLDVLASDPFARPPPFEKLVGDLAGTYSRRINIHHRLVYEVFPDQKIVRIL
RMWTHYD
VSWQLVYSRQAEKDAKKLAVAHLKKQTQALLDVLASDPFARPPPFEKLVGDLAGTYSRRINIHHRLVYEVFPDQKIVRIL
RMWTHYD
Download Length: 264 bp
>T154745 NZ_CP068247:1297836-1297931 [Staphylococcus sp. T93]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 81 a.a. Molecular weight: 8673.78 Da Isoelectric Point: 4.7144
>AT154745 WP_169112058.1 NZ_CP051684:1968301-1968543 [Duganella sp. AF9R3]
MDTISASEARARLYTLIDEAAASHAPVTITGKRNNAVLVSAEDWAAIQETLHLLSVPGMRESILAARAEPLENNSKELSW
MDTISASEARARLYTLIDEAAASHAPVTITGKRNNAVLVSAEDWAAIQETLHLLSVPGMRESILAARAEPLENNSKELSW
Download Length: 243 bp
>AT154745 NZ_CP068247:c1298018-1297959 [Staphylococcus sp. T93]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG