Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | pemIK/MazF-doc |
Location | 20704..21287 | Replicon | plasmid pSY333-41 |
Accession | NZ_CP051645 | ||
Organism | Staphylococcus caprae strain SY333 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A1S1GRQ5 |
Locus tag | HHJ99_RS13275 | Protein ID | WP_002436882.1 |
Coordinates | 20949..21287 (+) | Length | 113 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | HHJ99_RS13270 | Protein ID | WP_176746841.1 |
Coordinates | 20704..20952 (+) | Length | 83 a.a. |
Genomic Context
Location: 16085..16180 (96 bp)
Type: Others
Protein ID: WP_002441941.1
Type: Others
Protein ID: WP_002441941.1
Location: 17793..18131 (339 bp)
Type: Others
Protein ID: WP_002436858.1
Type: Others
Protein ID: WP_002436858.1
Location: 18350..19846 (1497 bp)
Type: Others
Protein ID: WP_170081014.1
Type: Others
Protein ID: WP_170081014.1
Location: 20198..20332 (135 bp)
Type: Others
Protein ID: WP_002436888.1
Type: Others
Protein ID: WP_002436888.1
Location: 20704..20952 (249 bp)
Type: Antitoxin
Protein ID: WP_176746841.1
Type: Antitoxin
Protein ID: WP_176746841.1
Location: 20949..21287 (339 bp)
Type: Toxin
Protein ID: WP_002436882.1
Type: Toxin
Protein ID: WP_002436882.1
Location: 21910..22584 (675 bp)
Type: Others
Protein ID: WP_145376072.1
Type: Others
Protein ID: WP_145376072.1
Location: 22874..24118 (1245 bp)
Type: Others
Protein ID: WP_145376082.1
Type: Others
Protein ID: WP_145376082.1
Location: 24393..25534 (1142 bp)
Type: Others
Protein ID: WP_152333551.1
Type: Others
Protein ID: WP_152333551.1
Location: 16448..16966 (519 bp)
Type: Others
Protein ID: WP_002441943.1
Type: Others
Protein ID: WP_002441943.1
Location: 17055..17690 (636 bp)
Type: Others
Protein ID: WP_170081013.1
Type: Others
Protein ID: WP_170081013.1
Location: 25793..26044 (252 bp)
Type: Others
Protein ID: WP_170081015.1
Type: Others
Protein ID: WP_170081015.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HHJ99_RS13240 | 16085..16180 | + | 96 | WP_002441941.1 | type I toxin-antitoxin system Fst family toxin | - |
HHJ99_RS13245 | 16448..16966 | - | 519 | WP_002441943.1 | type 1 glutamine amidotransferase | - |
HHJ99_RS13250 | 17055..17690 | - | 636 | WP_170081013.1 | 3-hexulose-6-phosphate synthase | - |
HHJ99_RS13255 | 17793..18131 | + | 339 | WP_002436858.1 | helix-turn-helix transcriptional regulator | - |
HHJ99_RS13260 | 18350..19846 | + | 1497 | WP_170081014.1 | malate dehydrogenase (quinone) | - |
HHJ99_RS13265 | 20198..20332 | + | 135 | WP_002436888.1 | beta-class phenol-soluble modulin | - |
HHJ99_RS13270 | 20704..20952 | + | 249 | WP_176746841.1 | AbrB family transcriptional regulator | Antitoxin |
HHJ99_RS13275 | 20949..21287 | + | 339 | WP_002436882.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
HHJ99_RS13280 | 21910..22584 | + | 675 | WP_145376072.1 | IS6 family transposase | - |
HHJ99_RS13285 | 22874..24118 | + | 1245 | WP_145376082.1 | aminoacyltransferase | - |
HHJ99_RS13290 | 24393..25534 | + | 1142 | WP_152333551.1 | IS3 family transposase | - |
HHJ99_RS13295 | 25793..26044 | - | 252 | WP_170081015.1 | DUF334 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaZ | - | 1..41252 | 41252 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 13019.98 Da Isoelectric Point: 6.9772
>T154596 WP_002436882.1 NZ_CP051645:20949-21287 [Staphylococcus caprae]
MSIKQFDILYIDLDPTRGREKQKIRPCLVVNNQMTINGTDFVWILPITSREVRFPTDIEVKTKNGLVTGVIDTIQIRSLD
LNARYHNYKDELQDNLKNDVIQAIQTYLNPTL
MSIKQFDILYIDLDPTRGREKQKIRPCLVVNNQMTINGTDFVWILPITSREVRFPTDIEVKTKNGLVTGVIDTIQIRSLD
LNARYHNYKDELQDNLKNDVIQAIQTYLNPTL
Download Length: 339 bp
>T154596 NZ_CP068155:56885-56992 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 83 a.a. Molecular weight: 9248.43 Da Isoelectric Point: 5.2090
>AT154596 WP_176746841.1 NZ_CP051645:20704-20952 [Staphylococcus caprae]
INKTSERIFKSGNSKAISLSKQTIQLADFEVGDKVEVQEMNGGLFIKKKEESIKDKITNFFKNGGKYTEEEIDFGESVGR
EI
INKTSERIFKSGNSKAISLSKQTIQLADFEVGDKVEVQEMNGGLFIKKKEESIKDKITNFFKNGGKYTEEEIDFGESVGR
EI
Download Length: 249 bp
>AT154596 NZ_CP068155:c56838-56772 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1S1GRQ5 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |