Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4602381..4603000 | Replicon | chromosome |
Accession | NZ_CP051548 | ||
Organism | Phytobacter diazotrophicus strain UAEU22 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A348DII6 |
Locus tag | HHA33_RS21895 | Protein ID | WP_041852465.1 |
Coordinates | 4602782..4603000 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A348DII5 |
Locus tag | HHA33_RS21890 | Protein ID | WP_041852464.1 |
Coordinates | 4602381..4602755 (+) | Length | 125 a.a. |
Genomic Context
Location: 4597492..4598688 (1197 bp)
Type: Others
Protein ID: WP_041852462.1
Type: Others
Protein ID: WP_041852462.1
Location: 4598711..4601860 (3150 bp)
Type: Others
Protein ID: WP_169039820.1
Type: Others
Protein ID: WP_169039820.1
Location: 4602381..4602755 (375 bp)
Type: Antitoxin
Protein ID: WP_041852464.1
Type: Antitoxin
Protein ID: WP_041852464.1
Location: 4602782..4603000 (219 bp)
Type: Toxin
Protein ID: WP_041852465.1
Type: Toxin
Protein ID: WP_041852465.1
Location: 4603069..4603635 (567 bp)
Type: Others
Protein ID: WP_041852466.1
Type: Others
Protein ID: WP_041852466.1
Location: 4603735..4604202 (468 bp)
Type: Others
Protein ID: WP_041852467.1
Type: Others
Protein ID: WP_041852467.1
Location: 4605725..4606426 (702 bp)
Type: Others
Protein ID: WP_041852469.1
Type: Others
Protein ID: WP_041852469.1
Location: 4604180..4605625 (1446 bp)
Type: Others
Protein ID: WP_169039821.1
Type: Others
Protein ID: WP_169039821.1
Location: 4606423..4606563 (141 bp)
Type: Others
Protein ID: WP_006818844.1
Type: Others
Protein ID: WP_006818844.1
Location: 4606567..4606827 (261 bp)
Type: Others
Protein ID: WP_041852470.1
Type: Others
Protein ID: WP_041852470.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HHA33_RS21880 | 4597492..4598688 | + | 1197 | WP_041852462.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
HHA33_RS21885 | 4598711..4601860 | + | 3150 | WP_169039820.1 | multidrug efflux RND transporter permease subunit AcrB | - |
HHA33_RS21890 | 4602381..4602755 | + | 375 | WP_041852464.1 | Hha toxicity modulator TomB | Antitoxin |
HHA33_RS21895 | 4602782..4603000 | + | 219 | WP_041852465.1 | hemolysin expression modulator Hha | Toxin |
HHA33_RS21900 | 4603069..4603635 | + | 567 | WP_041852466.1 | maltose O-acetyltransferase | - |
HHA33_RS21905 | 4603735..4604202 | + | 468 | WP_041852467.1 | membrane protein | - |
HHA33_RS21910 | 4604180..4605625 | - | 1446 | WP_169039821.1 | PLP-dependent aminotransferase family protein | - |
HHA33_RS21915 | 4605725..4606426 | + | 702 | WP_041852469.1 | GNAT family N-acetyltransferase | - |
HHA33_RS21920 | 4606423..4606563 | - | 141 | WP_006818844.1 | type B 50S ribosomal protein L36 | - |
HHA33_RS21925 | 4606567..4606827 | - | 261 | WP_041852470.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8685.14 Da Isoelectric Point: 8.9039
>T154428 WP_041852465.1 NZ_CP051548:4602782-4603000 [Phytobacter diazotrophicus]
MSDKPLTKIDYLMRLRRCQTIDTLERVIEKNKYELPDHELTVFYSAADHRLAELTMNKLYDKIPPSVWKFVR
MSDKPLTKIDYLMRLRRCQTIDTLERVIEKNKYELPDHELTVFYSAADHRLAELTMNKLYDKIPPSVWKFVR
Download Length: 219 bp
>T154428 NZ_CP068044:54448-54600 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 125 a.a. Molecular weight: 14600.44 Da Isoelectric Point: 5.5072
>AT154428 WP_041852464.1 NZ_CP051548:4602381-4602755 [Phytobacter diazotrophicus]
MDEYSPKRHDIAQLKFLCETLYHDCLLNLEESHHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNVSKANPVSHSC
MDEYSPKRHDIAQLKFLCETLYHDCLLNLEESHHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNVSKANPVSHSC
Download Length: 375 bp
>AT154428 NZ_CP068044:c54398-54336 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A348DII6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A348DII5 |